Recombinant Human FGF10 Protein, GST-tagged
Cat.No. : | FGF10-4099H |
Product Overview : | Human FGF10 full-length ORF ( NP_004456.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing. [provided by RefSeq |
Molecular Mass : | 49.8 kDa |
AA Sequence : | MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGF10 fibroblast growth factor 10 [ Homo sapiens ] |
Official Symbol | FGF10 |
Synonyms | FGF10; fibroblast growth factor 10; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria; |
Gene ID | 2255 |
mRNA Refseq | NM_004465 |
Protein Refseq | NP_004456 |
MIM | 602115 |
UniProt ID | O15520 |
◆ Recombinant Proteins | ||
FGF10-232H | Recombinant Human FGF10 protein | +Inquiry |
FGF10-422F | Active Recombinant Human FGF10 Protein (187 aa), N-His-tagged | +Inquiry |
FGF10-128H | Recombinant Human FGF10 Protein | +Inquiry |
FGF10-2324R | Recombinant Rat FGF10 Protein | +Inquiry |
FGF10-024H | Active Recombinant Human FGF10 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF10-6251HCL | Recombinant Human FGF10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF10 Products
Required fields are marked with *
My Review for All FGF10 Products
Required fields are marked with *
0
Inquiry Basket