Recombinant Chicken FGF10 Protein, His tagged
Cat.No. : | FGF10-6262C |
Product Overview : | Recombinant Chicken FGF10 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing. |
Molecular Mass : | The protein has a calculated MW of 22 kDa. |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMHDLGQDMLSPEATNSSSSSSSSFPSSFSSPSSAGRHVRSYNHLQGDVRKRKLYSYNKYFLKIEKNGKVSGTKKENCPFSILEITSVEIGVVAVKSIKSNYYLAMNKKGKVYGSKEFNSDCKLKERIEENGYNTYASLNWKHNGRQMFVALNGRGATKRGQKTRRKNTSAHFLPMVVMS |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.85 mg/mL by BCA |
Storage Buffer : | Sterile 50 mM Tris, 500 mM NaCl, pH 8.0 |
Gene Name | FGF10 fibroblast growth factor 10 [ Gallus gallus (chicken) ] |
Official Symbol | FGF10 |
Synonyms | FGF10; fibroblast growth factor 10 |
Gene ID | 395432 |
mRNA Refseq | NM_204696 |
Protein Refseq | NP_990027 |
UniProt ID | O42407 |
◆ Recombinant Proteins | ||
FGF10-421F | Active Recombinant Human FGF10 Protein (169 aa) | +Inquiry |
FGF10-523C | Recombinant Cynomolgus FGF10 Protein, His-tagged | +Inquiry |
FGF10-088F | Active Recombinant Human FGF10 Protein (170 aa, 40-208) | +Inquiry |
FGF10-6262C | Recombinant Chicken FGF10 Protein, His tagged | +Inquiry |
FGF10-024H | Active Recombinant Human FGF10 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF10-6251HCL | Recombinant Human FGF10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF10 Products
Required fields are marked with *
My Review for All FGF10 Products
Required fields are marked with *