Recombinant Human G6PC Protein, GST-tagged
Cat.No. : | G6PC-4613H |
Product Overview : | Human G6PC full-length ORF ( NP_000142.1, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Glucose-6-phosphatase is an integral membrane protein of the endoplasmic reticulum that catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate. It is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Defects in the enzyme cause glycogen storage disease type I (von Gierke disease). [provided by RefSeq |
Molecular Mass : | 66.9 kDa |
AA Sequence : | MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAMGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIVASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | G6PC glucose-6-phosphatase, catalytic subunit [ Homo sapiens ] |
Official Symbol | G6PC |
Synonyms | G6PC; glucose-6-phosphatase, catalytic subunit; G6PT, glucose 6 phosphatase, catalytic (glycogen storage disease type I, von Gierke disease); glucose-6-phosphatase; glycogen storage disease type I; von Gierke disease; GSD1a; G6Pase; G-6-Pase; G6Pase-alpha; glucose-6-phosphatase alpha; G6PT; GSD1; G6PC1; MGC163350; |
Gene ID | 2538 |
mRNA Refseq | NM_000151 |
Protein Refseq | NP_000142 |
MIM | 613742 |
UniProt ID | P35575 |
◆ Recombinant Proteins | ||
G6PC-4613H | Recombinant Human G6PC Protein, GST-tagged | +Inquiry |
RFL23531HF | Recombinant Full Length Haplochromis Xenognathus Glucose-6-Phosphatase(G6Pc) Protein, His-Tagged | +Inquiry |
G6PC-1543H | Recombinant Human G6PC protein, His-tagged | +Inquiry |
G6PC-5754H | Recombinant Human G6PC protein, His-tagged | +Inquiry |
G6PC-5122HF | Recombinant Full Length Human G6PC Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
G6PC-6082HCL | Recombinant Human G6PC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All G6PC Products
Required fields are marked with *
My Review for All G6PC Products
Required fields are marked with *