Recombinant Full Length Human G6PC Protein, GST-tagged
| Cat.No. : | G6PC-5122HF |
| Product Overview : | Human G6PC full-length ORF ( NP_000142.1, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 357 amino acids |
| Description : | Glucose-6-phosphatase is an integral membrane protein of the endoplasmic reticulum that catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate. It is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Defects in the enzyme cause glycogen storage disease type I (von Gierke disease). [provided by RefSeq |
| Molecular Mass : | 66.9 kDa |
| AA Sequence : | MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAMGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIVASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | G6PC glucose-6-phosphatase, catalytic subunit [ Homo sapiens ] |
| Official Symbol | G6PC |
| Synonyms | G6PC; glucose-6-phosphatase, catalytic subunit; G6PT, glucose 6 phosphatase, catalytic (glycogen storage disease type I, von Gierke disease); glucose-6-phosphatase; glycogen storage disease type I; von Gierke disease; GSD1a; G6Pase; G-6-Pase; G6Pase-alpha; glucose-6-phosphatase alpha; G6PT; GSD1; G6PC1; MGC163350; |
| Gene ID | 2538 |
| mRNA Refseq | NM_000151 |
| Protein Refseq | NP_000142 |
| MIM | 613742 |
| UniProt ID | P35575 |
| ◆ Recombinant Proteins | ||
| G6PC-5755H | Recombinant Human G6PC protein, His-sumostar-tagged | +Inquiry |
| RFL23531HF | Recombinant Full Length Haplochromis Xenognathus Glucose-6-Phosphatase(G6Pc) Protein, His-Tagged | +Inquiry |
| G6PC-1542H | Recombinant Human G6PC Protein, His-tagged | +Inquiry |
| G6PC-4613H | Recombinant Human G6PC Protein, GST-tagged | +Inquiry |
| G6PC-27523TH | Recombinant Human G6PC | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| G6PC-6082HCL | Recombinant Human G6PC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All G6PC Products
Required fields are marked with *
My Review for All G6PC Products
Required fields are marked with *
