Recombinant Full Length Haplochromis Xenognathus Glucose-6-Phosphatase(G6Pc) Protein, His-Tagged
Cat.No. : | RFL23531HF |
Product Overview : | Recombinant Full Length Haplochromis xenognathus Glucose-6-phosphatase(g6pc) Protein (O42154) (1-277aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haplochromis xenognathus (Lake Victoria cichlid) (Ptyochromis xenognathus) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-277) |
Form : | Lyophilized powder |
AA Sequence : | FGERPYWWVHETKFYGAGPAPSLQQFPITCETGPGSPSGHAMGAAGVWYVMVTALLSIAR EKQCPPLLYRFLYIGLWMLMGLVELVVCISRVYMAAHFPHQVIAGIITGTLVAEVVSKEK WIYSASLKKYFLITLFLTSFAVGFYVLLKALDVDLLWTMEKAQKWCIRPEWVHLDSAPFA SLLRNMGSLFGLGLGLHSPFYKTTKMRIMSAPLRIGCIVISVSLLHLLDGWTFSPENHMT FYALSFGKSAVALLIPTTLVPWALSKIYPVKTEGKNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | g6pc |
Synonyms | g6pc1; g6pc; g6pt; Glucose-6-phosphatase catalytic subunit 1; Glucose-6-phosphatase; G-6-Pase; G6Pase; Fragment |
UniProt ID | O42154 |
◆ Recombinant Proteins | ||
G6PC-27523TH | Recombinant Human G6PC | +Inquiry |
G6PC-5754H | Recombinant Human G6PC protein, His-tagged | +Inquiry |
G6PC-5755H | Recombinant Human G6PC protein, His-sumostar-tagged | +Inquiry |
G6PC-01HFL | Recombinant Human G6PC Protein, Full Length, N-His tagged | +Inquiry |
G6PC-2435R | Recombinant Rat G6PC Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
G6PC-6082HCL | Recombinant Human G6PC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All g6pc Products
Required fields are marked with *
My Review for All g6pc Products
Required fields are marked with *
0
Inquiry Basket