Recombinant Human GDF2 protein, His-tagged

Cat.No. : GDF2-4269H
Product Overview : Recombinant Human GDF2 protein(Q9UK05)(300-429aa), fused to N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 300-429aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 16.3 kDa
AA Sequence : HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name GDF2 growth differentiation factor 2 [ Homo sapiens ]
Official Symbol GDF2
Synonyms GDF2; growth differentiation factor 2; growth/differentiation factor 2; BMP 9; BMP9; GDF-2; bone morphogenetic protein 9; BMP-9;
Gene ID 2658
mRNA Refseq NM_016204
Protein Refseq NP_057288
MIM 605120
UniProt ID Q9UK05

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDF2 Products

Required fields are marked with *

My Review for All GDF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon