Recombinant Human GDF2 Protein (300-429 aa), His-tagged

• Cat.No.: GDF2-1823H
• Product Overview: Recombinant Human GDF2 Protein (300-429 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 300-429 aa
• Description: Potent circulating inhibitor of angiogenesis. Could be involved in bone formation. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 16.3 kDa
• AA Sequence: HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: GDF2 growth differentiation factor 2 [ Homo sapiens ]
• Official Symbol: GDF2
• Synonyms: GDF2; BMP 9; BMP9; GDF-2; BMP-9
• Gene ID: 2658
• mRNA Refseq: NM_016204
• Protein Refseq: NP_057288
• MIM: 605120
• UniProt ID: Q9UK05