Recombinant Human GDF2 Protein (300-429 aa), His-tagged
Cat.No. : | GDF2-1823H |
Product Overview : | Recombinant Human GDF2 Protein (300-429 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 300-429 aa |
Description : | Potent circulating inhibitor of angiogenesis. Could be involved in bone formation. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.3 kDa |
AA Sequence : | HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | GDF2 growth differentiation factor 2 [ Homo sapiens ] |
Official Symbol | GDF2 |
Synonyms | GDF2; BMP 9; BMP9; GDF-2; BMP-9; |
Gene ID | 2658 |
mRNA Refseq | NM_016204 |
Protein Refseq | NP_057288 |
MIM | 605120 |
UniProt ID | Q9UK05 |
◆ Recombinant Proteins | ||
GDF2-4269H | Recombinant Human GDF2 protein, His-tagged | +Inquiry |
Gdf2-373R | Recombinant Rat Gdf2 Protein, His-tagged | +Inquiry |
GDF2-13209H | Recombinant Human GDF2, His-tagged | +Inquiry |
GDF2-38H | Recombinant Human GDF2 protein, His-tagged | +Inquiry |
GDF2-3519M | Recombinant Mouse GDF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF2-5970HCL | Recombinant Human GDF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDF2 Products
Required fields are marked with *
My Review for All GDF2 Products
Required fields are marked with *