Recombinant Human GDF2 Protein (300-429 aa), His-tagged
| Cat.No. : | GDF2-1823H |
| Product Overview : | Recombinant Human GDF2 Protein (300-429 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 300-429 aa |
| Description : | Potent circulating inhibitor of angiogenesis. Could be involved in bone formation. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 16.3 kDa |
| AA Sequence : | HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | GDF2 growth differentiation factor 2 [ Homo sapiens ] |
| Official Symbol | GDF2 |
| Synonyms | GDF2; BMP 9; BMP9; GDF-2; BMP-9; |
| Gene ID | 2658 |
| mRNA Refseq | NM_016204 |
| Protein Refseq | NP_057288 |
| MIM | 605120 |
| UniProt ID | Q9UK05 |
| ◆ Recombinant Proteins | ||
| GDF2-0775H | Recombinant Human GDF2 Protein (Ser320-Arg429), C-His tagged | +Inquiry |
| GDF2-6286M | Recombinant Mouse GDF2 Protein | +Inquiry |
| GDF2-3535H | Recombinant Human GDF2 Protein (Ser320-Arg429), N-His tagged | +Inquiry |
| GDF2-38H | Recombinant Human GDF2 protein, His-tagged | +Inquiry |
| GDF2-0370H | Recombinant Human GDF2 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| BMP9-994R | Recombinant Rat BMP9 Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GDF2-5970HCL | Recombinant Human GDF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDF2 Products
Required fields are marked with *
My Review for All GDF2 Products
Required fields are marked with *



