Recombinant Human GDF2 Protein (300-429 aa), His-tagged

Cat.No. : GDF2-1823H
Product Overview : Recombinant Human GDF2 Protein (300-429 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 300-429 aa
Description : Potent circulating inhibitor of angiogenesis. Could be involved in bone formation. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 16.3 kDa
AA Sequence : HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name GDF2 growth differentiation factor 2 [ Homo sapiens ]
Official Symbol GDF2
Synonyms GDF2; BMP 9; BMP9; GDF-2; BMP-9;
Gene ID 2658
mRNA Refseq NM_016204
Protein Refseq NP_057288
MIM 605120
UniProt ID Q9UK05

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDF2 Products

Required fields are marked with *

My Review for All GDF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon