Recombinant Human GLI1 protein, His-tagged

Cat.No. : GLI1-4276H
Product Overview : Recombinant Human GLI1 protein(P08151)(921-1106aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 921-1106aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 23.3 kDa
AA Sequence : QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name GLI1 GLI family zinc finger 1 [ Homo sapiens ]
Official Symbol GLI1
Synonyms GLI1; GLI family zinc finger 1; GLI, glioma associated oncogene family zinc finger 1 , glioma associated oncogene homolog 1 (zinc finger protein); zinc finger protein GLI1; oncogene GLI; glioma-associated oncogene 1; glioma-associated oncogene homolog 1 (zinc finger protein); GLI;
Gene ID 2735
mRNA Refseq NM_001160045
Protein Refseq NP_001153517
MIM 165220
UniProt ID P08151

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLI1 Products

Required fields are marked with *

My Review for All GLI1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon