Recombinant Human GLI1 protein, His-tagged
| Cat.No. : | GLI1-3146H |
| Product Overview : | Recombinant Human GLI1 protein(470-659 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 470-659 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | NAGGSTEDLSSLDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GLI1 GLI family zinc finger 1 [ Homo sapiens ] |
| Official Symbol | GLI1 |
| Synonyms | GLI1; GLI family zinc finger 1; GLI, glioma associated oncogene family zinc finger 1 , glioma associated oncogene homolog 1 (zinc finger protein); zinc finger protein GLI1; oncogene GLI; glioma-associated oncogene 1; glioma-associated oncogene homolog 1 (zinc finger protein); GLI; |
| Gene ID | 2735 |
| mRNA Refseq | NM_001160045 |
| Protein Refseq | NP_001153517 |
| MIM | 165220 |
| UniProt ID | P08151 |
| ◆ Recombinant Proteins | ||
| GLI1-2807H | Recombinant Human GLI1 Protein (Phe2-Glu234), N-His tagged | +Inquiry |
| GLI1-312H | Recombinant Human GLI1 protein, MYC/DDK-tagged | +Inquiry |
| GLI1-4955H | Recombinant Human GLI1 Protein, GST/pstS1-tagged | +Inquiry |
| Gli1-3224M | Recombinant Mouse Gli1 Protein, Myc/DDK-tagged | +Inquiry |
| GLI1-4276H | Recombinant Human GLI1 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| GLI1-6401M | Recombinant Full Length Mouse GLI1 Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GLI1-5905HCL | Recombinant Human GLI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLI1 Products
Required fields are marked with *
My Review for All GLI1 Products
Required fields are marked with *
