Recombinant Human GLRX2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GLRX2-5547H |
Product Overview : | GLRX2 MS Standard C13 and N15-labeled recombinant protein (NP_057150) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the glutaredoxin family of proteins, which maintain cellular thiol homeostasis. These proteins are thiol-disulfide oxidoreductases that use a glutathione-binding site and one or two active cysteines in their active site. This gene undergoes alternative splicing to produce multiple isoforms, one of which is ubiquitously expressed and localizes to mitochondria, where it functions in mitochondrial redox homeostasis and is important for the protection against and recovery from oxidative stress. Other isoforms, which have more restrictive expression patterns, show cytosolic and nuclear localization, and are thought to function in cellular differentiation and transformation, possibly with a role in tumor progression. |
Molecular Mass : | 18.5 kDa |
AA Sequence : | MNPRDKQVSRFSPLKDVYTWVALAGIQRSGSPGRTRSAARRMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GLRX2 glutaredoxin 2 [ Homo sapiens (human) ] |
Official Symbol | GLRX2 |
Synonyms | GLRX2; glutaredoxin 2; bA101E13.1; bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2); GRX2; CGI-133; |
Gene ID | 51022 |
mRNA Refseq | NM_016066 |
Protein Refseq | NP_057150 |
MIM | 606820 |
UniProt ID | Q9NS18 |
◆ Recombinant Proteins | ||
GLRX2-2226R | Recombinant Rat GLRX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLRX2-1875R | Recombinant Rhesus monkey GLRX2 Protein, His-tagged | +Inquiry |
GLRX2-541Z | Recombinant Zebrafish GLRX2 | +Inquiry |
GLRX2-5347HF | Recombinant Full Length Human GLRX2 Protein, GST-tagged | +Inquiry |
GLRX2-5547H | Recombinant Human GLRX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRX2-714HCL | Recombinant Human GLRX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRX2 Products
Required fields are marked with *
My Review for All GLRX2 Products
Required fields are marked with *
0
Inquiry Basket