Recombinant Human GLRX2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GLRX2-5547H
Product Overview : GLRX2 MS Standard C13 and N15-labeled recombinant protein (NP_057150) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the glutaredoxin family of proteins, which maintain cellular thiol homeostasis. These proteins are thiol-disulfide oxidoreductases that use a glutathione-binding site and one or two active cysteines in their active site. This gene undergoes alternative splicing to produce multiple isoforms, one of which is ubiquitously expressed and localizes to mitochondria, where it functions in mitochondrial redox homeostasis and is important for the protection against and recovery from oxidative stress. Other isoforms, which have more restrictive expression patterns, show cytosolic and nuclear localization, and are thought to function in cellular differentiation and transformation, possibly with a role in tumor progression.
Molecular Mass : 18.5 kDa
AA Sequence : MNPRDKQVSRFSPLKDVYTWVALAGIQRSGSPGRTRSAARRMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GLRX2 glutaredoxin 2 [ Homo sapiens (human) ]
Official Symbol GLRX2
Synonyms GLRX2; glutaredoxin 2; bA101E13.1; bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2); GRX2; CGI-133;
Gene ID 51022
mRNA Refseq NM_016066
Protein Refseq NP_057150
MIM 606820
UniProt ID Q9NS18

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLRX2 Products

Required fields are marked with *

My Review for All GLRX2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon