"GLRX2" Related Products

Expand

Recombinant Human GLRX2 Protein, GST-tagged

Cat.No. : GLRX2-4976H
Product Overview : Human GLRX2 full-length ORF ( AAH28113, 1 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
Description : Glutaredoxins (e.g., GLRX; MIM 600443) are a family of glutathione-dependent hydrogen donors that participate in a variety of cellular redox reactions.[supplied by OMIM
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 39.38 kDa
AA Sequence : MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : GLRX2 glutaredoxin 2 [ Homo sapiens ]
Official Symbol : GLRX2
Synonyms : GLRX2; glutaredoxin 2; bA101E13.1; bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2); GRX2; CGI-133;
Gene ID : 51022
mRNA Refseq : NM_001243399
Protein Refseq : NP_001230328
MIM : 606820
UniProt ID : Q9NS18

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.