Recombinant Human GNA13 protein, GST-tagged
Cat.No. : | GNA13-27H |
Product Overview : | Recombinant Human GNA13(1 a.a. - 377 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 377 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 67.21 kDa |
AA Sequence : | MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQD FDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIR ALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGG QRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLM LQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | GNA13 guanine nucleotide binding protein (G protein), alpha 13 [ Homo sapiens ] |
Official Symbol | GNA13 |
Synonyms | GNA13; guanine nucleotide binding protein (G protein), alpha 13; guanine nucleotide-binding protein subunit alpha-13; G13; MGC46138; g alpha-13; G-protein subunit alpha-13; |
Gene ID | 10672 |
mRNA Refseq | NM_006572 |
Protein Refseq | NP_006563 |
MIM | 604406 |
UniProt ID | Q14344 |
Chromosome Location | 17q24 |
Pathway | CXCR4-mediated signaling events, organism-specific biosystem; G Protein Signaling Pathways, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Hemostasis, organism-specific biosystem; LPA receptor mediated events, organism-specific biosystem; |
Function | D5 dopamine receptor binding; G-protein beta/gamma-subunit complex binding; GTP binding; GTPase activity; guanyl nucleotide binding; metal ion binding; nucleotide binding; protein binding; signal transducer activity; type 1 angiotensin receptor binding; |
◆ Recombinant Proteins | ||
GNA13-27H | Recombinant Human GNA13 protein, GST-tagged | +Inquiry |
GNA13-13343H | Recombinant Human GNA13, His-tagged | +Inquiry |
GNA13-2591R | Recombinant Rat GNA13 Protein | +Inquiry |
GNA13-187H | Recombinant Human GNA13 protein, GST-tagged | +Inquiry |
GNA13-616HF | Recombinant Full Length Human GNA13 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNA13-720HCL | Recombinant Human GNA13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNA13 Products
Required fields are marked with *
My Review for All GNA13 Products
Required fields are marked with *
0
Inquiry Basket