Recombinant Human GNA13 protein, GST-tagged

Cat.No. : GNA13-27H
Product Overview : Recombinant Human GNA13(1 a.a. - 377 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 377 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 67.21 kDa
AA Sequence : MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQD FDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIR ALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGG QRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLM LQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name GNA13 guanine nucleotide binding protein (G protein), alpha 13 [ Homo sapiens ]
Official Symbol GNA13
Synonyms GNA13; guanine nucleotide binding protein (G protein), alpha 13; guanine nucleotide-binding protein subunit alpha-13; G13; MGC46138; g alpha-13; G-protein subunit alpha-13;
Gene ID 10672
mRNA Refseq NM_006572
Protein Refseq NP_006563
MIM 604406
UniProt ID Q14344
Chromosome Location 17q24
Pathway CXCR4-mediated signaling events, organism-specific biosystem; G Protein Signaling Pathways, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Hemostasis, organism-specific biosystem; LPA receptor mediated events, organism-specific biosystem;
Function D5 dopamine receptor binding; G-protein beta/gamma-subunit complex binding; GTP binding; GTPase activity; guanyl nucleotide binding; metal ion binding; nucleotide binding; protein binding; signal transducer activity; type 1 angiotensin receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNA13 Products

Required fields are marked with *

My Review for All GNA13 Products

Required fields are marked with *

0
cart-icon