Recombinant Human GPX3 Protein, His-tagged

Cat.No. : GPX3-5310H
Product Overview : Human GPX3 (NP_002075, 21 a.a. - 226 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 21-226 a.a.
Description : This gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3 UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq
Form : Liquid
Molecular Mass : 25.7 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYCGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
Purity : > 85% by SDS-PAGE
Applications : SDS-PAGE
Storage : Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 0.25 mg/mL
Storage Buffer : In 20 mM Tris-HCl, 150 mM NaCl, pH 7.5 (40% glycerol, 1 mM DTT)
Gene Name GPX3 glutathione peroxidase 3 (plasma) [ Homo sapiens ]
Official Symbol GPX3
Synonyms GPX3; glutathione peroxidase 3 (plasma); glutathione peroxidase 3; GPx-3; plasma glutathione peroxidase; extracellular glutathione peroxidase; GPx-P; GSHPx-3; GSHPx-P;
Gene ID 2878
mRNA Refseq NM_002084
Protein Refseq NP_002075
MIM 138321
UniProt ID P22352

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPX3 Products

Required fields are marked with *

My Review for All GPX3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon