Recombinant Human GPX3 Protein, His-tagged
Cat.No. : | GPX3-5310H |
Product Overview : | Human GPX3 (NP_002075, 21 a.a. - 226 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-226 a.a. |
Description : | This gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3 UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 25.7 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYCGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK |
Purity : | > 85% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 0.25 mg/mL |
Storage Buffer : | In 20 mM Tris-HCl, 150 mM NaCl, pH 7.5 (40% glycerol, 1 mM DTT) |
Gene Name | GPX3 glutathione peroxidase 3 (plasma) [ Homo sapiens ] |
Official Symbol | GPX3 |
Synonyms | GPX3; glutathione peroxidase 3 (plasma); glutathione peroxidase 3; GPx-3; plasma glutathione peroxidase; extracellular glutathione peroxidase; GPx-P; GSHPx-3; GSHPx-P; |
Gene ID | 2878 |
mRNA Refseq | NM_002084 |
Protein Refseq | NP_002075 |
MIM | 138321 |
UniProt ID | P22352 |
◆ Recombinant Proteins | ||
GPX3-2332R | Recombinant Rat GPX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPX3-3974C | Recombinant Chicken GPX3 | +Inquiry |
GPX3-7216Z | Recombinant Zebrafish GPX3 | +Inquiry |
Gpx3-284M | Recombinant Mouse Gpx3, FLAG-tagged | +Inquiry |
GPX3-953H | Recombinant Human GPX3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPX3 Products
Required fields are marked with *
My Review for All GPX3 Products
Required fields are marked with *
0
Inquiry Basket