"GPX3" Related Products

Expand
Expand

Recombinant Human GPX3 Protein, His-tagged

Cat.No.: GPX3-5310H
Product Overview: Human GPX3 (NP_002075, 21 a.a. - 226 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Description: This gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3 UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq
Source: E. coli
Species: Human
Tag : His
Form: Liquid
Molecular Mass: 25.7 kDa
AA Sequence: MGSSHHHHHHSSGLVPRGSHMQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYCGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
Purity: > 85% by SDS-PAGE
Applications: SDS-PAGE
Storage: Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration: 0.25 mg/mL
Storage Buffer: In 20 mM Tris-HCl, 150 mM NaCl, pH 7.5 (40% glycerol, 1 mM DTT)
Gene Name: GPX3 glutathione peroxidase 3 (plasma) [ Homo sapiens ]
Official Symbol: GPX3
Synonyms: GPX3; glutathione peroxidase 3 (plasma); glutathione peroxidase 3; GPx-3; plasma glutathione peroxidase; extracellular glutathione peroxidase; GPx-P; GSHPx-3; GSHPx-P;
Gene ID: 2878
mRNA Refseq: NM_002084
Protein Refseq: NP_002075
MIM: 138321
UniProt ID: P22352

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.