Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GPX3, His-tagged

Cat.No. : GPX3-29077TH
Product Overview : Recombinant fragment, corresponding to amino acids 93-226 of Human Glutathione Peroxidase 3 with an N terminal His tag. Predicted MWt: 16 kDa;
  • Specification
  • Gene Information
  • Related Products
Description : This gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3 UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal.
Conjugation : HIS
Source : E. coli
Tissue specificity : Secreted in plasma.
Form : Lyophilised:Reconstitute with 88 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNF QLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLF WEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVK MDILSYMRRQAALGVKRK
Sequence Similarities : Belongs to the glutathione peroxidase family.
Gene Name : GPX3 glutathione peroxidase 3 (plasma) [ Homo sapiens ]
Official Symbol : GPX3
Synonyms : GPX3; glutathione peroxidase 3 (plasma); glutathione peroxidase 3;
Gene ID : 2878
mRNA Refseq : NM_002084
Protein Refseq : NP_002075
MIM : 138321
Uniprot ID : P22352
Chromosome Location : 5q23
Pathway : Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Folate Metabolism, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem;
Function : glutathione binding; glutathione peroxidase activity; glutathione peroxidase activity; oxidoreductase activity; selenium binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends