Recombinant Human GPX3, His-tagged
Cat.No. : | GPX3-29077TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 93-226 of Human Glutathione Peroxidase 3 with an N terminal His tag. Predicted MWt: 16 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 93-226 a.a. |
Description : | This gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3 UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. |
Conjugation : | HIS |
Tissue specificity : | Secreted in plasma. |
Form : | Lyophilised:Reconstitute with 88 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNF QLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLF WEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVK MDILSYMRRQAALGVKRK |
Sequence Similarities : | Belongs to the glutathione peroxidase family. |
Gene Name | GPX3 glutathione peroxidase 3 (plasma) [ Homo sapiens ] |
Official Symbol | GPX3 |
Synonyms | GPX3; glutathione peroxidase 3 (plasma); glutathione peroxidase 3; |
Gene ID | 2878 |
mRNA Refseq | NM_002084 |
Protein Refseq | NP_002075 |
MIM | 138321 |
Uniprot ID | P22352 |
Chromosome Location | 5q23 |
Pathway | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Folate Metabolism, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; |
Function | glutathione binding; glutathione peroxidase activity; glutathione peroxidase activity; oxidoreductase activity; selenium binding; |
◆ Recombinant Proteins | ||
GPX3-7232M | Recombinant Mouse GPX3 Protein | +Inquiry |
GPX3-2332R | Recombinant Rat GPX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gpx3-22M | Recombinant Mouse Gpx3 Protein | +Inquiry |
GPX3-2213H | Recombinant Human GPX3 Protein, His-tagged | +Inquiry |
GPX3-1928H | Recombinant Human Glutathione Peroxidase 3 (plasma), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPX3 Products
Required fields are marked with *
My Review for All GPX3 Products
Required fields are marked with *
0
Inquiry Basket