Recombinant Human GPX3, His-tagged

• Cat.No.: GPX3-29077TH
• Product Overview: Recombinant fragment, corresponding to amino acids 93-226 of Human Glutathione Peroxidase 3 with an N terminal His tag. Predicted MWt: 16 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 93-226 a.a.
• Description: This gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3 UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal.
• Conjugation: HIS
• Tissue specificity: Secreted in plasma.
• Form: Lyophilised:Reconstitute with 88 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNF QLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLF WEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVK MDILSYMRRQAALGVKRK
• Sequence Similarities: Belongs to the glutathione peroxidase family.

Gene Information

• Gene Name: GPX3 glutathione peroxidase 3 (plasma) [ Homo sapiens ]
• Official Symbol: GPX3
• Synonyms: GPX3; glutathione peroxidase 3 (plasma); glutathione peroxidase 3
• Gene ID: 2878
• mRNA Refseq: NM_002084
• Protein Refseq: NP_002075
• MIM: 138321
• Uniprot ID: P22352
• Chromosome Location: 5q23
• Pathway: Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Folate Metabolism, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem
• Function: glutathione binding; glutathione peroxidase activity; glutathione peroxidase activity; oxidoreductase activity; selenium binding