Recombinant Human GSTM4 Protein, GST-tagged

• Cat.No.: GSTM4-4420H
• Product Overview: Human GSTM4 full-length ORF ( AAH15513, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. Multiple transcript variants, each encoding a distinct protein isoform, have been identified. [provided by RefSeq
• Molecular Mass: 49.72 kDa
• AA Sequence: MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GSTM4 glutathione S-transferase mu 4 [ Homo sapiens ]
• Official Symbol: GSTM4
• Synonyms: GSTM4; glutathione S-transferase mu 4; glutathione S transferase M4; glutathione S-transferase Mu 4; GST-Mu2; GTS-Mu2; GST class-mu 4; glutathione S-transferase M4; glutathione S-aryltransferase M4; glutathione S-alkyltransferase M4; glutathione S-aralkyltransferase M4; S-(hydroxyalkyl)glutathione lyase M4; GTM4; GSTM4-4; MGC9247; MGC131945
• Gene ID: 2948
• mRNA Refseq: NM_000850
• Protein Refseq: NP_000841
• MIM: 138333
• UniProt ID: Q03013