Recombinant Full Length Human GSTM4 Protein, GST-tagged
Cat.No. : | GSTM4-3364HF |
Product Overview : | Human GSTM4 full-length ORF ( AAH15513, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 218 amino acids |
Description : | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. Multiple transcript variants, each encoding a distinct protein isoform, have been identified. [provided by RefSeq |
Molecular Mass : | 49.72 kDa |
AA Sequence : | MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GSTM4 glutathione S-transferase mu 4 [ Homo sapiens ] |
Official Symbol | GSTM4 |
Synonyms | GSTM4; glutathione S-transferase mu 4; glutathione S transferase M4; glutathione S-transferase Mu 4; GST-Mu2; GTS-Mu2; GST class-mu 4; glutathione S-transferase M4; glutathione S-aryltransferase M4; glutathione S-alkyltransferase M4; glutathione S-aralkyltransferase M4; S-(hydroxyalkyl)glutathione lyase M4; GTM4; GSTM4-4; MGC9247; MGC131945; |
Gene ID | 2948 |
mRNA Refseq | NM_000850 |
Protein Refseq | NP_000841 |
MIM | 138333 |
UniProt ID | Q03013 |
◆ Recombinant Proteins | ||
GSTM4-323C | Recombinant Cynomolgus Monkey GSTM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTM4-1692H | Recombinant Human Glutathione S-Transferase Mu 4, His-tagged | +Inquiry |
GSTM4-2557H | Recombinant Human GSTM4 Protein (Arg18-Trp215), N-His tagged | +Inquiry |
Gstm4-652R | Recombinant Rat Gstm4 protein, His & T7-tagged | +Inquiry |
GSTM4-4420H | Recombinant Human GSTM4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTM4-5711HCL | Recombinant Human GSTM4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSTM4 Products
Required fields are marked with *
My Review for All GSTM4 Products
Required fields are marked with *
0
Inquiry Basket