Recombinant Human HLA-G Protein, Fc tagged
Cat.No. : | HLA-G-1242H |
Product Overview : | Recombinant Human HLA-G Protein with Fc tag was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293T |
Tag : | Fc |
Description : | HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail. |
Molecular Mass : | 65.2 kDa |
AA Sequence : | MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSDLEVLFQGPEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | < 1.0 EU/μg by LAL |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 or -80 centigrade. Avoid freeze/thaw cycles. |
Storage Buffer : | Sterile PBS, pH 7.4 |
Concentration : | 0.76 mg/mL |
Gene Name | HLA-G major histocompatibility complex, class I, G [ Homo sapiens (human) ] |
Official Symbol | HLA-G |
Synonyms | HLA-G; major histocompatibility complex, class I, G; HLA G histocompatibility antigen, class I, G; HLA class I histocompatibility antigen, alpha chain G; b2 microglobulin; HLA G antigen; HLA class I molecule; MHC class I antigen G; HLA-G histocompatibility antigen, class I, G; MHC-G |
Gene ID | 3135 |
mRNA Refseq | NM_002127 |
Protein Refseq | NP_002118 |
MIM | 142871 |
UniProt ID | P17693 |
◆ Recombinant Proteins | ||
HLA-G-033H | Recombinant Human HLA-G Protein, His-tagged | +Inquiry |
HLA-G-502H | Recombinant Human HLA-G protein(Gly25-Thr305(C66S)), His-Avi-tagged | +Inquiry |
HLA-G-001H | Active Recombinant Human HLA-G Protein, Myc/DDK-tagged | +Inquiry |
HLA-G-503H | Recombinant Human HLA-G protein, His-Avi-tagged, Biotinylated | +Inquiry |
HLA-G-1718HFL | Recombinant Full Length Human HLA-G Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
HLA-G-1242H | Recombinant Human HLA-G Protein, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-G-5493HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-G Products
Required fields are marked with *
My Review for All HLA-G Products
Required fields are marked with *
0
Inquiry Basket