Recombinant Human HSD17B11, His-tagged

Cat.No. : HSD17B11-28398TH
Product Overview : Recombinant fragment corresponding to amino acids 20-285 of Human Hsd17b11 with an N terminal His tag; 287 amino acids with tag, MWt 31.4 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 266 amino acids
Description : Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al.
Conjugation : HIS
Molecular Weight : 31.400kDa inclusive of tags
Tissue specificity : Present at high level in steroidogenic cells such as syncytiotrophoblasts, sebaceous gland, Leydig cells, and granulosa cells of the dominant follicle and corpus luteum. In lung, it is detected in the ciliated epithelium and in acini of adult trachea, in
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKI
Sequence Similarities : Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.
Gene Name HSD17B11 hydroxysteroid (17-beta) dehydrogenase 11 [ Homo sapiens ]
Official Symbol HSD17B11
Synonyms HSD17B11; hydroxysteroid (17-beta) dehydrogenase 11; dehydrogenase/reductase (SDR family) member 8 , DHRS8; estradiol 17-beta-dehydrogenase 11; 17 BETA HSD11; 17 BETA HSDXI; PAN1B; retinal short chain dehydrogenase/reductase 2; RetSDR2; SDR16C2; short cha
Gene ID 51170
mRNA Refseq NM_016245
Protein Refseq NP_057329
MIM 612831
Uniprot ID Q8NBQ5
Chromosome Location 4q22.1
Function estradiol 17-beta-dehydrogenase activity; nucleotide binding; steroid dehydrogenase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD17B11 Products

Required fields are marked with *

My Review for All HSD17B11 Products

Required fields are marked with *

0
cart-icon