Recombinant Human HSD17B11, His-tagged
Cat.No. : | HSD17B11-28398TH |
Product Overview : | Recombinant fragment corresponding to amino acids 20-285 of Human Hsd17b11 with an N terminal His tag; 287 amino acids with tag, MWt 31.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 266 amino acids |
Description : | Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al. |
Conjugation : | HIS |
Molecular Weight : | 31.400kDa inclusive of tags |
Tissue specificity : | Present at high level in steroidogenic cells such as syncytiotrophoblasts, sebaceous gland, Leydig cells, and granulosa cells of the dominant follicle and corpus luteum. In lung, it is detected in the ciliated epithelium and in acini of adult trachea, in |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKI |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily. |
Gene Name | HSD17B11 hydroxysteroid (17-beta) dehydrogenase 11 [ Homo sapiens ] |
Official Symbol | HSD17B11 |
Synonyms | HSD17B11; hydroxysteroid (17-beta) dehydrogenase 11; dehydrogenase/reductase (SDR family) member 8 , DHRS8; estradiol 17-beta-dehydrogenase 11; 17 BETA HSD11; 17 BETA HSDXI; PAN1B; retinal short chain dehydrogenase/reductase 2; RetSDR2; SDR16C2; short cha |
Gene ID | 51170 |
mRNA Refseq | NM_016245 |
Protein Refseq | NP_057329 |
MIM | 612831 |
Uniprot ID | Q8NBQ5 |
Chromosome Location | 4q22.1 |
Function | estradiol 17-beta-dehydrogenase activity; nucleotide binding; steroid dehydrogenase activity; |
◆ Recombinant Proteins | ||
HSD17B11-3632H | Recombinant Human HSD17B11 protein, His&Myc-tagged | +Inquiry |
HSD17B11-598C | Recombinant Cynomolgus HSD17B11 Protein, His-tagged | +Inquiry |
HSD17B11-1975R | Recombinant Rhesus Macaque HSD17B11 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B11-2578R | Recombinant Rat HSD17B11 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B11-4694H | Recombinant Human HSD17B11 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B11-473HCL | Recombinant Human HSD17B11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B11 Products
Required fields are marked with *
My Review for All HSD17B11 Products
Required fields are marked with *
0
Inquiry Basket