Recombinant Full Length Human HSD17B11 Protein, C-Flag-tagged

• Cat.No.: HSD17B11-53HFL
• Product Overview: Recombinant Full Length Human HSD17B11 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 32.8 kDa
• AA Sequence: MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINK HGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKT FEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITG VKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAV
  LKRKISVKFDAVIGYKMKAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Secreted Protein
• Full Length: Full L.

Gene Information

• Gene Name: HSD17B11 hydroxysteroid 17-beta dehydrogenase 11 [ Homo sapiens (human) ]
• Official Symbol: HSD17B11
• Synonyms: DHRS8; PAN1B; RETSDR2; SDR16C2; 17BHSD11; 17-BETA-HSD11; 17-BETA-HSDXI
• Gene ID: 51170
• mRNA Refseq: NM_016245.5
• Protein Refseq: NP_057329.3
• MIM: 612831
• UniProt ID: Q8NBQ5