Recombinant Full Length Human HSD17B11 Protein, C-Flag-tagged
| Cat.No. : | HSD17B11-53HFL | 
| Product Overview : | Recombinant Full Length Human HSD17B11 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Mammalian Cells | 
| Tag : | Flag | 
| Description : | Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones. | 
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
| Molecular Mass : | 32.8 kDa | 
| AA Sequence : | MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINK HGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKT FEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITG VKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAV LKRKISVKFDAVIGYKMKAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Storage : | Store at -80 centigrade. | 
| Concentration : | >50 ug/mL as determined by microplate BCA method. | 
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Protein Families : | Druggable Genome, Secreted Protein | 
| Full Length : | Full L. | 
| Gene Name | HSD17B11 hydroxysteroid 17-beta dehydrogenase 11 [ Homo sapiens (human) ] | 
| Official Symbol | HSD17B11 | 
| Synonyms | DHRS8; PAN1B; RETSDR2; SDR16C2; 17BHSD11; 17-BETA-HSD11; 17-BETA-HSDXI | 
| Gene ID | 51170 | 
| mRNA Refseq | NM_016245.5 | 
| Protein Refseq | NP_057329.3 | 
| MIM | 612831 | 
| UniProt ID | Q8NBQ5 | 
| ◆ Recombinant Proteins | ||
| HSD17B11-13955H | Recombinant Human HSD17B11, His-tagged | +Inquiry | 
| Hsd17b11-524M | Recombinant Mouse Hsd17b11 Protein, MYC/DDK-tagged | +Inquiry | 
| HSD17B11-1102H | Recombinant Human HSD17B11 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| HSD17B11-598C | Recombinant Cynomolgus HSD17B11 Protein, His-tagged | +Inquiry | 
| HSD17B11-2131H | Recombinant Human HSD17B11 Protein, MYC/DDK-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| HSD17B11-473HCL | Recombinant Human HSD17B11 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B11 Products
Required fields are marked with *
My Review for All HSD17B11 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            