Recombinant Full Length Human HSD17B11 Protein, C-Flag-tagged
Cat.No. : | HSD17B11-53HFL |
Product Overview : | Recombinant Full Length Human HSD17B11 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.8 kDa |
AA Sequence : | MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINK HGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKT FEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITG VKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAV LKRKISVKFDAVIGYKMKAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | HSD17B11 hydroxysteroid 17-beta dehydrogenase 11 [ Homo sapiens (human) ] |
Official Symbol | HSD17B11 |
Synonyms | DHRS8; PAN1B; RETSDR2; SDR16C2; 17BHSD11; 17-BETA-HSD11; 17-BETA-HSDXI |
Gene ID | 51170 |
mRNA Refseq | NM_016245.5 |
Protein Refseq | NP_057329.3 |
MIM | 612831 |
UniProt ID | Q8NBQ5 |
◆ Recombinant Proteins | ||
HSD17B11-13955H | Recombinant Human HSD17B11, His-tagged | +Inquiry |
Hsd17b11-524M | Recombinant Mouse Hsd17b11 Protein, MYC/DDK-tagged | +Inquiry |
HSD17B11-1102H | Recombinant Human HSD17B11 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B11-598C | Recombinant Cynomolgus HSD17B11 Protein, His-tagged | +Inquiry |
HSD17B11-2131H | Recombinant Human HSD17B11 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B11-473HCL | Recombinant Human HSD17B11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B11 Products
Required fields are marked with *
My Review for All HSD17B11 Products
Required fields are marked with *