Recombinant Human ICOSLG Protein
Cat.No. : | ICOSLG-598H |
Product Overview : | Recombinant human ICOSLG protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 302 |
Description : | Enables identical protein binding activity. Predicted to be involved in T cell receptor signaling pathway and positive regulation of interleukin-4 production. Located in cytoplasmic ribonucleoprotein granule and plasma membrane. |
Form : | Lyophilized |
Molecular Mass : | 27.5 kDa |
AA Sequence : | MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | ICOSLG inducible T-cell co-stimulator ligand [ Homo sapiens (human) ] |
Official Symbol | ICOSLG |
Synonyms | ICOSLG; inducible T-cell co-stimulator ligand; ICOSL; ICOS ligand; B7 homolog 2; B7 homologue 2; B7 H2; B7 related protein 1; B7H2; B7RP 1; B7RP1; CD275; GL50; ICOS L; KIAA0653; B7-like protein Gl50; B7-related protein 1; transmembrane protein B7-H2 ICOS ligand; B7-H2; LICOS; B7RP-1; ICOS-L; |
Gene ID | 23308 |
mRNA Refseq | NM_015259 |
Protein Refseq | NP_056074 |
MIM | 605717 |
UniProt ID | O75144 |
◆ Recombinant Proteins | ||
ICOSLG-1514R | Recombinant Rhesus Monkey ICOSLG Protein, hIgG1-tagged | +Inquiry |
ICOSLG-168H | Recombinant Human ICOSLG Protein, DDK/His-tagged | +Inquiry |
ICOSLG-598H | Recombinant Human ICOSLG Protein | +Inquiry |
ICOSLG-1232CAF555 | Recombinant Cynomolgus ICOSLG Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
ICOSLG-1215H | Active Recombinant Human ICOSLG, HIgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ICOSLG-1095HCL | Recombinant Human ICOSLG cell lysate | +Inquiry |
ICOSLG-2804MCL | Recombinant Mouse ICOSLG Overexpression Lysate(Met 1-Lys 279) | +Inquiry |
ICOSLG-2618MCL | Recombinant Mouse ICOSLG Overexpression Lysate(Met 1-Lys 279) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ICOSLG Products
Required fields are marked with *
My Review for All ICOSLG Products
Required fields are marked with *
0
Inquiry Basket