Recombinant Human ICOSLG Protein

Cat.No. : ICOSLG-598H
Product Overview : Recombinant human ICOSLG protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Protein Length : 302
Description : Enables identical protein binding activity. Predicted to be involved in T cell receptor signaling pathway and positive regulation of interleukin-4 production. Located in cytoplasmic ribonucleoprotein granule and plasma membrane.
Form : Lyophilized
Molecular Mass : 27.5 kDa
AA Sequence : MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name ICOSLG inducible T-cell co-stimulator ligand [ Homo sapiens (human) ]
Official Symbol ICOSLG
Synonyms ICOSLG; inducible T-cell co-stimulator ligand; ICOSL; ICOS ligand; B7 homolog 2; B7 homologue 2; B7 H2; B7 related protein 1; B7H2; B7RP 1; B7RP1; CD275; GL50; ICOS L; KIAA0653; B7-like protein Gl50; B7-related protein 1; transmembrane protein B7-H2 ICOS ligand; B7-H2; LICOS; B7RP-1; ICOS-L;
Gene ID 23308
mRNA Refseq NM_015259
Protein Refseq NP_056074
MIM 605717
UniProt ID O75144

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ICOSLG Products

Required fields are marked with *

My Review for All ICOSLG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon