Recombinant Human IFNGR1, Fc-tagged
Cat.No. : | IFNGR1-28503TH |
Product Overview : | Recombinant fragment, corresponding to the extracellular domain (amino acids 18-245) of Human IFNGR1 fused to the Fc region of Human IgG1 (aa 93-330). The chimeric protein was expressed in modified Human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Fc |
Protein Length : | 18-245 a.a. |
Description : | This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. |
Conjugation : | Fc |
Biological activity : | The ED50 of IFNGR1 (Fc Chimera) is typically 0.05-0.1 μg/ml as measured by its ability to neutralize IFN gamma mediated cytotoxicity using the HT-29 colorectal adenocarcinoma cell line. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical sequence: EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQ VPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGD PSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPK LDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYI RVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGGS SNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHY TQKSLSLSPGK |
Sequence Similarities : | Belongs to the type II cytokine receptor family.Contains 2 fibronectin type-III domains.Contains 2 Ig-like C2-type (immunoglobulin-like) domains. |
Gene Name | IFNGR1 interferon gamma receptor 1 [ Homo sapiens ] |
Official Symbol | IFNGR1 |
Synonyms | IFNGR1; interferon gamma receptor 1; IFNGR; CD119; |
Gene ID | 3459 |
mRNA Refseq | NM_000416 |
Protein Refseq | NP_000407 |
MIM | 107470 |
Uniprot ID | P15260 |
Chromosome Location | 6q23-q24 |
Pathway | Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
Function | cytokine binding; interferon-gamma receptor activity; receptor activity; |
◆ Recombinant Proteins | ||
IFNGR1-57H | Recombinant Human Interferon Gamma Receptor 1 | +Inquiry |
IFNGR1-2250H | Active Recombinant Human IFNGR1 protein, His-tagged | +Inquiry |
IFNGR1-1591H | Active Recombinant Human IFNGR1 protein, Fc-tagged | +Inquiry |
IFNGR1-1151H | Recombinant Human IFNGR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFNGR1-1590H | Active Recombinant Human IFNGR1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IFNGR1-71H | Active Recombinant Human IFNGR1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNGR1-1775MCL | Recombinant Mouse IFNGR1 cell lysate | +Inquiry |
IFNGR1-2646HCL | Recombinant Human IFNGR1 cell lysate | +Inquiry |
IFNGR1-1175RCL | Recombinant Rat IFNGR1 cell lysate | +Inquiry |
IFNGR1-1003CCL | Recombinant Cynomolgus IFNGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNGR1 Products
Required fields are marked with *
My Review for All IFNGR1 Products
Required fields are marked with *
0
Inquiry Basket