Recombinant Full Length Mouse Interferon Gamma Receptor 1(Ifngr1) Protein, His-Tagged
| Cat.No. : | RFL15391MF |
| Product Overview : | Recombinant Full Length Mouse Interferon gamma receptor 1(Ifngr1) Protein (P15261) (26-477aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (26-477) |
| Form : | Lyophilized powder |
| AA Sequence : | ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTN ISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKE EQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNE TLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKDSIWILVVAPLTV FTVVILVFAYWYTKKNSFKRKSIMLPKSLLSVVKSATLETKPESKYSLVTPHQPAVLESE TVICEEPLSTVTAPDSPEAAEQEELSKETKALEAGGSTSAMTPDSPPTPTQRRSFSLLSS NQSGPCSLTAYHSRNGSDSGLVGSGSSISDLESLPNNNSETKMAEHDPPPVRKAPMASGY DKPHMLVDVLVDVGGKESLMGYRLTGEAQELS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Ifngr1 |
| Synonyms | Ifngr1; Ifngr; Interferon gamma receptor 1; IFN-gamma receptor 1; IFN-gamma-R1; Interferon gamma receptor alpha-chain; IFN-gamma-R-alpha; CD antigen CD119 |
| UniProt ID | P15261 |
| ◆ Recombinant Proteins | ||
| IFNGR1-7855H | Recombinant Human IFNGR1 protein, His-Flag-tagged | +Inquiry |
| IFNGR1-4425H | Recombinant Human IFNGR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ifngr1-7039M | Recombinant Mouse Ifngr1 protein, GST-tagged | +Inquiry |
| IFNGR1-298H | Recombinant Human IFNGR1 Protein, Fc-tagged | +Inquiry |
| IFNGR1-143H | Recombinant Human IFNGR1 | +Inquiry |
| ◆ Native Proteins | ||
| Ifngr1-43M | Active Recombinant Mouse Ifngr1 Homodimer Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNGR1-2646HCL | Recombinant Human IFNGR1 cell lysate | +Inquiry |
| IFNGR1-1775MCL | Recombinant Mouse IFNGR1 cell lysate | +Inquiry |
| IFNGR1-1175RCL | Recombinant Rat IFNGR1 cell lysate | +Inquiry |
| IFNGR1-1003CCL | Recombinant Cynomolgus IFNGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifngr1 Products
Required fields are marked with *
My Review for All Ifngr1 Products
Required fields are marked with *
