Recombinant Human IFNGR1 protein
Cat.No. : | IFNGR1-116H |
Product Overview : | Recombinant human IFNGR1 extracellular domain cDNA (18-245 aa fragment) fused with 29aa tag fusion protein at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 18-245 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEV KNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEE KQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQY CVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Used as a soluble / functional protein for interfeson pathway and iPS generation efficiency study.2. As excellent subunit receptor protein for heterodimer dynamic interaction study.3. As immunogen for specific antibody production. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | IFNGR1 interferon gamma receptor 1 [ Homo sapiens ] |
Official Symbol | IFNGR1 |
Synonyms | IFNGR1; interferon gamma receptor 1; IFNGR; CD119; CDw119; AVP, type 2; IFN-gamma-R1; CD119 antigen; IFN-gamma receptor 1 |
Gene ID | 3459 |
mRNA Refseq | NM_000416 |
Protein Refseq | NP_000407 |
MIM | 107470 |
UniProt ID | P15260 |
Chromosome Location | 6q23-q24 |
Pathway | Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
Function | cytokine binding; interferon-gamma receptor activity; receptor activity; |
◆ Recombinant Proteins | ||
IFNGR1-001H | Recombinant Human IFNGR1 Protein, His-tagged | +Inquiry |
IFNGR1-1207C | Active Recombinant Cynomolgus IFNGR1 Protein, Fc-tagged | +Inquiry |
IFNGR1-1589M | Active Recombinant Mouse IFNGR1 protein, His-tagged | +Inquiry |
IFNGR1-116H | Recombinant Human IFNGR1 protein | +Inquiry |
Ifngr1-1652M | Recombinant Mouse Ifngr1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IFNGR1-71H | Active Recombinant Human IFNGR1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNGR1-1775MCL | Recombinant Mouse IFNGR1 cell lysate | +Inquiry |
IFNGR1-1003CCL | Recombinant Cynomolgus IFNGR1 cell lysate | +Inquiry |
IFNGR1-1175RCL | Recombinant Rat IFNGR1 cell lysate | +Inquiry |
IFNGR1-2646HCL | Recombinant Human IFNGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNGR1 Products
Required fields are marked with *
My Review for All IFNGR1 Products
Required fields are marked with *
0
Inquiry Basket