"IFNGR1" Related Products

Expand
Expand

Recombinant Human IFNGR1 protein

Cat.No.: IFNGR1-116H
Product Overview: Recombinant human IFNGR1 extracellular domain cDNA (18-245 aa fragment) fused with 29aa tag fusion protein at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEV KNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEE KQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQY CVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG
Purity: >90% by SDS-PAGE
Applications: 1. Used as a soluble / functional protein for interfeson pathway and iPS generation efficiency study.2. As excellent subunit receptor protein for heterodimer dynamic interaction study.3. As immunogen for specific antibody production.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: IFNGR1 interferon gamma receptor 1 [ Homo sapiens ]
Official Symbol: IFNGR1
Synonyms: IFNGR1; interferon gamma receptor 1; IFNGR; CD119; CDw119; AVP, type 2; IFN-gamma-R1; CD119 antigen; IFN-gamma receptor 1
Gene ID: 3459
mRNA Refseq: NM_000416
Protein Refseq: NP_000407
MIM: 107470
UniProt ID: P15260
Chromosome Location: 6q23-q24
Pathway: Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function: cytokine binding; interferon-gamma receptor activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.