Recombinant Human IL12A Protein
Cat.No. : | IL12A-310H |
Product Overview : | Recombinant Human IL12A was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Description : | This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS,pH7.4 |
Molecular Mass : | 57.2kD |
AA Sequence : | RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | IL12A interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35) [ Homo sapiens ] |
Official Symbol | IL12A |
Synonyms | IL12A; interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); NKSF1; interleukin-12 subunit alpha; CLMF; cytotoxic lymphocyte maturation factor 1; p35; IL 12; subunit p35; IL 12A; IL35 subunit; interleukin 12; interleukin 12 alpha chain; natural killer cell stimulatory factor 1; 35 kD subunit; NF cell stimulatory factor chain 1; NFSK; CLMF p35; IL-12 subunit p35; IL-12, subunit p35; interleukin 12, p35; interleukin-12 alpha chain; NK cell stimulatory factor chain 1; cytotoxic lymphocyte maturation factor 1, p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; natural killer cell stimulatory factor 1, 35 kD subunit; P35; IL-12A; |
Gene ID | 3592 |
mRNA Refseq | NM_000882 |
Protein Refseq | NP_000873 |
MIM | 161560 |
UniProt ID | P29459 |
◆ Recombinant Proteins | ||
IL12-21H | Recombinant Human Interleukin-12 | +Inquiry |
IL12A-75H | Recombinant Human IL12A Protein | +Inquiry |
IL12A-062H | Active Recombinant Human IL12 Protein | +Inquiry |
IL12A-9483R | Recombinant Rhesus IL12A protein, hFc-tagged | +Inquiry |
IL12A-309H | Recombinant Human IL12A protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12A-2435HCL | Recombinant Human IL12A cell lysate | +Inquiry |
IL12A-001CCL | Recombinant Cynomolgus IL12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL12A Products
Required fields are marked with *
My Review for All IL12A Products
Required fields are marked with *
0
Inquiry Basket