Recombinant Human IL15 Protein, GMP Grade, Animal-Free

Cat.No. : IL15-35HG
Product Overview : GMP Recombinant Human IL15 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : IL-15 is an immunomodulating cytokine that stimulates the proliferation of T lymphocytes and shares many biological properties with IL-2. IL-15 exerts its biological activities primarily on T cells. It is also essential in the development, survival and activation of NK cells.
AA Sequence : MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity : ≥ 98% by SDS-PAGE gel and HPLC analyses.
Gene Name IL15 interleukin 15 [ Homo sapiens (human) ]
Official Symbol IL15
Synonyms IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15;
Gene ID 3600
mRNA Refseq NM_000585
Protein Refseq NP_000576
MIM 600554
UniProt ID P40933

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL15 Products

Required fields are marked with *

My Review for All IL15 Products

Required fields are marked with *

0
cart-icon