Active Recombinant Human IL17A Protein
Cat.No. : | IL17A-102H |
Product Overview : | Recombinant Human Interleukin-17A is produced by our E.coli expression system and the target gene encoding Ile20-Ala155 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | Ile20-Ala155 |
Description : | Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. As IL-17 shares properties with IL-1 and TNF-alpha, it may induce joint inflammation and bone and cartilage destruction. This cytokine is found in synovial fluids of patients with rheumatoid arthritis, and produced by rheumatoid arthritis synovium. It increases IL-6 production, induces collagen degradation and decreases collagen synthesis by synovium and cartilage and proteoglycan synthesis in cartilage. IL-17 is also able to increase bone destruction and reduce its formation. Blocking of interleukin-17 with specific inhibitors provides a protective inhibition of cartilage and bone degradation. |
Form : | Lyophilized from a 0.2 um filtered solution of 20mM PB, pH 7.4. |
Bio-activity : | ED50 is approximately 2 ng/ml. Specific Activity of 5 x 10^5 IU/mg. Measured by the dose-dependent induction of IL-6 in primary human foreskin fibroblasts. |
AA Sequence : | MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERY PSVIWEAKCRHLGCIN ADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | IL17A interleukin 17A [ Homo sapiens (human) ] |
Official Symbol | IL17A |
Synonyms | Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A |
Gene ID | 3605 |
mRNA Refseq | NM_002190.3 |
Protein Refseq | NP_002181.1 |
MIM | 603149 |
UniProt ID | Q16552 |
◆ Recombinant Proteins | ||
IL17A-140M | Recombinant Mouse IL-17AF Heterodimer Protein | +Inquiry |
IL17A-254I | Active Recombinant Human IL17A Protein (142 aa), His-tagged | +Inquiry |
IL17A-288H | Recombinant Human IL17A, StrepII-tagged | +Inquiry |
IL17A-97H | Recombinant Human IL-17A | +Inquiry |
IL17A-570H | Active Recombinant Human Interleukin 17A, MIgG2a Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
0
Inquiry Basket