Active Recombinant Human IL17A Protein (142 aa), His-tagged

Cat.No. : IL17A-254I
Product Overview : Recombinant human Interleukin-17A (rhIL-17A) produced in CHO cells is a glycosylated homodimer chain containing 142 amino acids. A fully biologically active molecule, rhIL-17A has a molecular mass of around 14-22 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : His
Protein Length : 142
Description : Interleukin-17A (IL-17A),also known as CTLA-8 and IL-17, is a proinflammatory cytokine belonging to the IL-17 family. It is secreted by Th17 cells, gamma/delta T cells, NK cells and neutrophils. IL-17A signals through IL-17 receptor A in a complex with receptor C or D to regulate NF-kappaB and MAP kinase activities. IL-17A plays important roles in the anti-microbial response and chronic inflammation. It stimulates the production of IL-6, IL-8 and G-CSF in epithelial and endothelial cells, and induces the expression of ICAM-1 in fibroblasts. Clinically, IL-17A has been associated with inflammatory diseases, such as rheumatoid arthritis, psoriasis and multiple sclerosis.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.3 ng/mL, measured in a bioassay using NHDF cells, corresponding to a specific activity of > 3.3 × 10^6 units/mg.
Molecular Mass : 14-22 kDa, observed by reducing SDS-PAGE.
AA Sequence : GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant humanInterleukin-17A (IL-17A), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human Interleukin-17A (IL-17A), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name IL17A interleukin 17A [ Homo sapiens ]
Official Symbol IL17A
Synonyms IL17A; interleukin 17A; CTLA8, IL17, interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8); interleukin-17A; cytotoxic T lymphocyte associated protein 8; IL 17; IL 17A; CTLA-8; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; cytotoxic T-lymphocyte-associated serine esterase 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); IL17; CTLA8; IL-17; IL-17A;
Gene ID 3605
mRNA Refseq NM_002190
Protein Refseq NP_002181
MIM 603149
UniProt ID Q16552

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL17A Products

Required fields are marked with *

My Review for All IL17A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon