Active Recombinant Human IL1RN Protein
Cat.No. : | IL1RN-104H |
Product Overview : | Recombinant Human Interleukin-1 Receptor Antagonist Protein is produced by our E.coli expression system and the target gene encoding Arg26-Glu177 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | Arg26-Glu177 |
Description : | Interleukin-1 Receptor Antagonist (IL-1RN) is a member of the IL-1 family. Endogenous IL-1RN is produced in numerous animal disease models as well as in human autoimmune and chronic inflammatory diseases. It binds to IL-1 receptors in competition with IL-1, but does not elicit intracellular response from this binding. Its role in counteracting the proinflammatory effects of IL-1 is being studied by numerous research groups. IL-4 and IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble and intracellular forms of IL-1RN. The regulated expression of IL-1RN in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts, IL-1, TNF-alpha, or PDGF markedly enhances the synthesis of IL-1RN. |
Form : | Lyophilized from a 0.2 um filtered solution of 50mM TrisHCl, 200mM NaCl, pH 7.5. |
Bio-activity : | Measured by the dose-dependent inhibition of IL-1 stimulation of D10S cells. ED50 is 0.5 ng/ml. Specific Activity of 2.0 x 10^6 IU/mg. |
AA Sequence : | MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKM CLSCVKSGDETRLQLEA VNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYF QEDE |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | IL1RN interleukin 1 receptor antagonist [ Homo sapiens (human) ] |
Official Symbol | IL1RN |
Synonyms | Interleukin-1 Receptor Antagonist Protein; IL-1RN; IL-1ra; IRAP; ICIL-1RA; IL1 Inhibitor; Anakinra; DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1ra3 |
Gene ID | 3557 |
mRNA Refseq | NM_000577.5 |
Protein Refseq | NP_000568.1 |
MIM | 147679 |
UniProt ID | P18510 |
◆ Recombinant Proteins | ||
Il1rn-8709R | Active Recombinant Rat Il1rn protein, hFc-tagged | +Inquiry |
IL1RN-1893HFL | Recombinant Full Length Human IL1RN Protein, C-Flag-tagged | +Inquiry |
IL1RN-0278C | Recombinant Cynomolgus IL1RN protein, His-tagged | +Inquiry |
IL1RN-104H | Active Recombinant Human IL1RN Protein | +Inquiry |
IL1RN-094C | Recombinant Cynomolgus IL1RN protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *
0
Inquiry Basket