Recombinant Full Length Human IL1RN Protein, C-Flag-tagged
Cat.No. : | IL1RN-1893HFL |
Product Overview : | Recombinant Full Length Human IL1RN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.1 kDa |
AA Sequence : | MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEK IDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAA CPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | IL1RN interleukin 1 receptor antagonist [ Homo sapiens (human) ] |
Official Symbol | IL1RN |
Synonyms | DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA |
Gene ID | 3557 |
mRNA Refseq | NM_173842.3 |
Protein Refseq | NP_776214.1 |
MIM | 147679 |
UniProt ID | P18510 |
◆ Recombinant Proteins | ||
IL1RN-3569H | Recombinant Human IL1RN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Il1rn-1244M | Recombinant Mouse Il1rn Protein, MYC/DDK-tagged | +Inquiry |
IL1RN-104I | Active Recombinant Human IL1RN Protein (153 aa) | +Inquiry |
Il1rn-168M | Recombinant Active Mouse IL1RN Protein, His-tagged(C-ter) | +Inquiry |
IL1RN-3596H | Recombinant Human IL1RN protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *
0
Inquiry Basket