Recombinant Human IL21 Protein

Cat.No. : IL21-864H
Product Overview : Recombinant Human IL21, transcript variant 1, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Non
Description : This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.2
Molecular Mass : 16.5kD
AA Sequence : MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name IL21 interleukin 21 [ Homo sapiens ]
Official Symbol IL21
Synonyms IL21; interleukin 21; interleukin-21; IL 21; Za11; interleukin-21 isoform; IL-21;
Gene ID 59067
mRNA Refseq NM_001207006
Protein Refseq NP_001193935
MIM 605384
UniProt ID Q9HBE4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL21 Products

Required fields are marked with *

My Review for All IL21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon