Recombinant Human IL21 Protein
Cat.No. : | IL21-864H |
Product Overview : | Recombinant Human IL21, transcript variant 1, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Description : | This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.2 |
Molecular Mass : | 16.5kD |
AA Sequence : | MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | IL21 interleukin 21 [ Homo sapiens ] |
Official Symbol | IL21 |
Synonyms | IL21; interleukin 21; interleukin-21; IL 21; Za11; interleukin-21 isoform; IL-21; |
Gene ID | 59067 |
mRNA Refseq | NM_001207006 |
Protein Refseq | NP_001193935 |
MIM | 605384 |
UniProt ID | Q9HBE4 |
◆ Recombinant Proteins | ||
Il21-6742M | Recombinant Mouse Il21 Protein (Pro25-Ser146), N-His tagged | +Inquiry |
IL21-174H | Recombinant Active Human IL21 Protein, His-tagged(C-ter) | +Inquiry |
Il21-338M | Active Recombinant Mouse Il21, Fc-tagged | +Inquiry |
IL21-022M | Active Recombinant Mouse IL21, MIgG2a Fc-tagged, mutant | +Inquiry |
IL21-5818H | Recombinant Human IL21 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL21 Products
Required fields are marked with *
My Review for All IL21 Products
Required fields are marked with *
0
Inquiry Basket