Recombinant Mouse Il21 protein
Cat.No. : | Il21-169M |
Product Overview : | Recombinant Mouse Il21 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 129 |
Description : | This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human N1186 T cells is less than 25 ng/ml, corresponding to a specific activity of > 4.0 × 10⁴ IU/mg. |
Molecular Mass : | Approximately 15.0 kDa, a single non-glycosylated polypeptide chain containing 129 amino acids. |
AA Sequence : | HKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS |
Endotoxin : | Less than 0.1 EU/μg of rMuIL-21 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il21 |
Official Symbol | Il21 |
Synonyms | IL21; interleukin 21; interleukin-21; IL-21; |
Gene ID | 60505 |
mRNA Refseq | NM_021782 |
Protein Refseq | NP_068554 |
UniProt ID | Q9ES17 |
◆ Recombinant Proteins | ||
IL21-021M | Active Recombinant Mouse IL21, MIgG2a Fc-tagged | +Inquiry |
IL21-6949Z | Recombinant Zebrafish IL21 | +Inquiry |
IL21-2065R | Recombinant Rhesus Macaque IL21 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL21-117H | Recombinant Human IL21 Protein | +Inquiry |
Il21-01M | Active Recombinant Mouse Il21 Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il21 Products
Required fields are marked with *
My Review for All Il21 Products
Required fields are marked with *
0
Inquiry Basket