Recombinant Human IL21 Protein
Cat.No. : | IL21-117H |
Product Overview : | Recombinant Human Interleukin-21 is produced by our E.coli expression system and the target gene encoding Gln23-Ser155 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | Gln23-Ser155 |
Description : | IL-21 induces the production of IgG1 and IgG3 in B-cells. IL-21 may promote the transition between innate and adaptive immunity. IL-21 may have a role in proliferation and maturation of natural killer cells in synergy with IL15. IL-21 stimulates interferon gamma production in T-cells and natural killer cells by synergy with IL15 and IL18. Dysregulation of IL-21 has a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. |
Form : | Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.2. |
AA Sequence : | MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINV SIKKLKRKPPSTN AGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | IL21 interleukin 21 [ Homo sapiens (human) ] |
Official Symbol | IL21 |
Synonyms | Interleukin-21; Za11; IL-21; CVID11 |
Gene ID | 59067 |
mRNA Refseq | NM_021803.4 |
Protein Refseq | NP_068575.1 |
MIM | 605384 |
UniProt ID | Q9HBE4 |
◆ Recombinant Proteins | ||
IL21-01H | Active Recombinant Human IL21 Protein (aa 32-162), N-Fc-tagged | +Inquiry |
IL21-161H | Active Recombinant Human IL21 Protein | +Inquiry |
IL21-0288H | Active Recombinant Human IL21 protein | +Inquiry |
Il21-361I | Active Recombinant Mouse Il21 Protein (123 aa) | +Inquiry |
IL21-238B | Recombinant Bovine Interleukin 21 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL21 Products
Required fields are marked with *
My Review for All IL21 Products
Required fields are marked with *