Species : |
Mouse |
Source : |
E.coli |
Protein Length : |
123 |
Description : |
Interleukin-21 (IL-21) belongs to the Type I four helix bundle cytokines, and shares the common cytokine receptor γ chain with IL-2, IL-4, IL-7, IL-9, and IL-15. IL-21 is expressed by CD4+ T cells, natural killer (NK) T cells, and Th17 cells. The IL-21 receptor is highly expressed on CD4+ and CD8+ B cells. IL-21 plays a pivotal role in the survival and proliferation of B cells, and their differentiation to immunoglobulin (Ig) producing cells. IL-21regulates the production of IgG1 and IgE by B cells, and diminishes the severity of allergy and asthma. In some cases, IL-21 induces B cell apoptosis. Other roles of IL-21 include regulation of the innate immune system, implication in autoimmunity, and antitumor activity. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 1 ng/mL, measured by its ability to stimulate the proliferation of human ANBL-6 cells, corresponding to a specific activity of > 1.0 × 10^6 units/mg. |
Molecular Mass : |
15.1 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by SDS-PAGE. |
Storage : |
Lyophilized recombinant mouse interleukin-21 (IL-21) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, mouse interleukin-21 (IL-21) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |