Recombinant Human IL3RA protein, T7/His-tagged
Cat.No. : | IL3RA-109H |
Product Overview : | Recombinant human CD123 cDNA (19-305 aa, derived from BC035407) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 19-305 a.a. |
Form : | 0.2 mg/ml in sterile-filtered solution in 20 mM Tris, pH 7.5. Proprietary formulation of NaCl , KCl, EDTA, arginine, DTT, and glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVN NSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLY LNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMT AKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQ RFECDQEEGANTRAWR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro CD123 mediated IL3 signaling regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD123 protein-protein interaction assay.3. Potential diagnostic biomarker for acute myeloid leukemia and lupus dieases.4. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ] |
Official Symbol | IL3RA |
Synonyms | IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123; IL-3RA; IL-3R-alpha; CD123 antigen; IL-3R subunit alpha; IL-3 receptor subunit alpha; IL-3 receptor alpha SP2 isoform; IL3R; IL3RX; IL3RY; IL3RAY; hIL-3Ra; M |
Gene ID | 3563 |
mRNA Refseq | NM_002183 |
Protein Refseq | NP_002174 |
MIM | 308385 |
UniProt ID | P26951 |
Chromosome Location | Xp22.3 and Yp13.3 |
Pathway | Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
Function | interleukin-3 receptor activity; receptor activity; |
◆ Recombinant Proteins | ||
IL3RA-178H | Recombinant Human IL3RA Protein, Fc\Avi-tagged | +Inquiry |
IL3RA-0212H | Recombinant Human IL3RA protein, His-tagged, FITC-Labeled | +Inquiry |
IL3RA-29795THAF488 | Recombinant Human IL3RA Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
IL3RA-29795THAF647 | Recombinant Human IL3RA Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
IL3RA-556H | Recombinant Human IL3RA Protein (Thr19-Arg305), C-hFc and 6×His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3RA-2433HCL | Recombinant Human IL3RA cell lysate | +Inquiry |
IL3RA-742CCL | Recombinant Canine IL3RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL3RA Products
Required fields are marked with *
My Review for All IL3RA Products
Required fields are marked with *