Recombinant Human IL3RA protein, T7/His-tagged
| Cat.No. : | IL3RA-109H |
| Product Overview : | Recombinant human CD123 cDNA (19-305 aa, derived from BC035407) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 19-305 a.a. |
| Form : | 0.2 mg/ml in sterile-filtered solution in 20 mM Tris, pH 7.5. Proprietary formulation of NaCl , KCl, EDTA, arginine, DTT, and glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVN NSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLY LNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMT AKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQ RFECDQEEGANTRAWR |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro CD123 mediated IL3 signaling regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD123 protein-protein interaction assay.3. Potential diagnostic biomarker for acute myeloid leukemia and lupus dieases.4. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ] |
| Official Symbol | IL3RA |
| Synonyms | IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123; IL-3RA; IL-3R-alpha; CD123 antigen; IL-3R subunit alpha; IL-3 receptor subunit alpha; IL-3 receptor alpha SP2 isoform; IL3R; IL3RX; IL3RY; IL3RAY; hIL-3Ra; M |
| Gene ID | 3563 |
| mRNA Refseq | NM_002183 |
| Protein Refseq | NP_002174 |
| MIM | 308385 |
| UniProt ID | P26951 |
| Chromosome Location | Xp22.3 and Yp13.3 |
| Pathway | Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
| Function | interleukin-3 receptor activity; receptor activity; |
| ◆ Recombinant Proteins | ||
| IL3RA-3248HA | Recombinant Human IL3RA protein, Fc-His-tagged, APC labeled | +Inquiry |
| IL3RA-1557R | Recombinant Rhesus Monkey IL3RA Protein, hIgG1-tagged | +Inquiry |
| IL3RA-29795THAF555 | Recombinant Human IL3RA Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| IL3RA-03M | Recombinant Mouse IL3RA Protein, hIgG-His-tagged | +Inquiry |
| IL3RA-1578C | Recombinant Cynomolgus Monkey IL3RA Protein, hIgG1-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL3RA-742CCL | Recombinant Canine IL3RA cell lysate | +Inquiry |
| IL3RA-2433HCL | Recombinant Human IL3RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL3RA Products
Required fields are marked with *
My Review for All IL3RA Products
Required fields are marked with *




