Recombinant Human IL7 Protein, His-tagged

Cat.No. : IL7-121H
Product Overview : Recombinant Human Interleukin-7 is produced by our Mammalian expression system and the target gene encoding Asp26-His177 is expressed with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : His
Protein Length : Asp26-His177
Description : Human Interleukin 7 (IL-7) is a potent lymphoid cell growth factor stimulating the proliferation of lymphoid progenitors. IL7 can associate with the hepatocyte growth factor (HGF) to form a hybrid cytokine that functions as a pre-pro-B cell growth-stimulating factor. Human IL7 cDNA encodes a 177 amino acid precursor protein containing a 25 amino acid signal peptide and a 152 amino acid mature protein. Human and mouse IL7 share 65% sequence identity in the mature region and both exhibit cross-species activity. IL-7 signals via IL-7 receptor (IL7R) activating multiple pathways including JaK/STAT and PI3K/AKT, which regulate lymphocyte survival, glucose uptake, proliferation, and differentiation. IL-7 is also associated with cytoplasmic IL2-R gamma for signal transduction.
Form : Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
AA Sequence : DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFL KMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRL LQEIKTCWNKILMGTKEHVDHHHHHH
Endotoxin : Less than 0.1 ng/ug (1 EU/ug).
Purity : >95%
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting
Reconstitution : It is not recommended to reconstitute to a concentration less than 100μg/ml.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Quality Statement : Greater than 95% as determined by reducing SDS-PAGE.
Shipping : The product is shipped at ambient temperature.
Upon receipt, store it immediately at the temperature listed below.
Gene Name IL7 interleukin 7 [ Homo sapiens (human) ]
Official Symbol IL7
Synonyms Interleukin-7; IL-7
Gene ID 3574
mRNA Refseq NM_000880.4
Protein Refseq NP_000871.1
MIM 146660
UniProt ID P13232

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL7 Products

Required fields are marked with *

My Review for All IL7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon