Recombinant Human IL7 Protein, His-tagged
| Cat.No. : | IL7-55H |
| Product Overview : | Recombinant Human IL7 Protein, fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Description : | The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. IL7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. IL7 plays an essential role in lymphoid cell survival, and in the maintenance of naive and memory T cells. |
| Form : | PBS, pH7.4. |
| Molecular Mass : | 18.21 kDa |
| AA Sequence : | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.3 mg/ml |
| Gene Name | IL7 interleukin 7 [ Homo sapiens (human) ] |
| Official Symbol | IL7 |
| Synonyms | IL-7 |
| Gene ID | 3574 |
| mRNA Refseq | NM_000880 |
| Protein Refseq | NP_000871 |
| MIM | 146660 |
| UniProt ID | P13232 |
| ◆ Recombinant Proteins | ||
| IL7-233H | Recombinant Human IL7 | +Inquiry |
| IL7-5170H | Recombinant Human IL7 Protein, GST-tagged | +Inquiry |
| Il7-77M | Recombinant Mouse Il7 protein | +Inquiry |
| IL7-187H | Active Recombinant Human IL7 Protein | +Inquiry |
| IL7-743R | Recombinant Rabbit IL7 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *



