Recombinant Human IL7 Protein, His-tagged
Cat.No. : | IL7-55H |
Product Overview : | Recombinant Human IL7 Protein, fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. IL7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. IL7 plays an essential role in lymphoid cell survival, and in the maintenance of naive and memory T cells. |
Form : | PBS, pH7.4. |
Molecular Mass : | 18.21 kDa |
AA Sequence : | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.3 mg/ml |
Gene Name | IL7 interleukin 7 [ Homo sapiens (human) ] |
Official Symbol | IL7 |
Synonyms | IL-7 |
Gene ID | 3574 |
mRNA Refseq | NM_000880 |
Protein Refseq | NP_000871 |
MIM | 146660 |
UniProt ID | P13232 |
◆ Recombinant Proteins | ||
Il7-742M | Recombinant Mouse Il7 protein, His-tagged | +Inquiry |
Il7-578R | Recombinant Rat Il7 protein | +Inquiry |
IL7-271H | Recombinant Human IL7, StrepII-tagged | +Inquiry |
IL7-092I | Active Recombinant Human IL7 Protein (153 aa) | +Inquiry |
Il7-0299R | Active Recombinant Rat Il7 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *
0
Inquiry Basket