Recombinant Chicken IL7 Protein, His-tagged
Cat.No. : | IL7-01C |
Product Overview : | Recombinant Chicken IL7 Protein, fused to His-tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. IL7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. IL7 plays an essential role in lymphoid cell survival, and in the maintenance of naive and memory T cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Form : | 50mM Tris, 300mM NaCl, pH 8.0. |
Molecular Mass : | 15 kDa |
AA Sequence : | MHHHHHHSSCTMGNKTTEIRVKYENILSHDIEELVNMSAEYRDRCCKNKRHEHNKVFFCNDTQEIGSLQSMACNMLRFFNKQKINKEFRRKAALVSCGTLQVLQCKCERHKKEKSINASCSQISGKEQQ |
Endotoxin : | <1EU/ug by LAL |
Purity : | > 90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.056 mg/ml |
Publications : |
Clonal anergy of CD117+chB6+ B cell progenitors induced by avian leukosis virus subgroup J is associated with immunological tolerance (2019)
|
Gene Name | IL7 interleukin 7 [ Gallus gallus (chicken) ] |
Official Symbol | IL7 |
Synonyms | IL-7 |
Gene ID | 420193 |
mRNA Refseq | NM_001398241 |
Protein Refseq | NP_001385170 |
UniProt ID | B1GVZ6 |
◆ Recombinant Proteins | ||
IL7-2077R | Recombinant Rhesus Macaque IL7 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL7-5170H | Recombinant Human IL7 Protein, GST-tagged | +Inquiry |
IL7-1371B | Recombinant Bovine IL7 protein, His-tagged | +Inquiry |
IL7-188M | Active Recombinant Mouse IL7 Protein | +Inquiry |
IL7-66H | Recombinant Human Interleukin 7, 152aa | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *