Recombinant Chicken IL7 Protein, His-tagged

Cat.No. : IL7-01C
Product Overview : Recombinant Chicken IL7 Protein, fused to His-tag, was expressed in E. coli.
Availability June 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Chicken
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. IL7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. IL7 plays an essential role in lymphoid cell survival, and in the maintenance of naive and memory T cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Form : 50mM Tris, 300mM NaCl, pH 8.0.
Molecular Mass : 15 kDa
AA Sequence : MHHHHHHSSCTMGNKTTEIRVKYENILSHDIEELVNMSAEYRDRCCKNKRHEHNKVFFCNDTQEIGSLQSMACNMLRFFNKQKINKEFRRKAALVSCGTLQVLQCKCERHKKEKSINASCSQISGKEQQ
Endotoxin : <1EU/ug by LAL
Purity : > 90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.056 mg/ml
Publications :
Clonal anergy of CD117+chB6+ B cell progenitors induced by avian leukosis virus subgroup J is associated with immunological tolerance (2019)
Gene Name IL7 interleukin 7 [ Gallus gallus (chicken) ]
Official Symbol IL7
Synonyms IL-7
Gene ID 420193
mRNA Refseq NM_001398241
Protein Refseq NP_001385170
UniProt ID B1GVZ6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL7 Products

Required fields are marked with *

My Review for All IL7 Products

Required fields are marked with *

0
cart-icon