Recombinant Chicken IL7 Protein, His-tagged

• Cat.No.: IL7-01C
• Product Overview: Recombinant Chicken IL7 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Chicken
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. IL7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. IL7 plays an essential role in lymphoid cell survival, and in the maintenance of naive and memory T cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
• Form: 50mM Tris, 300mM NaCl, pH 8.0.
• Molecular Mass: 15 kDa
• AA Sequence: MHHHHHHSSCTMGNKTTEIRVKYENILSHDIEELVNMSAEYRDRCCKNKRHEHNKVFFCNDTQEIGSLQSMACNMLRFFNKQKINKEFRRKAALVSCGTLQVLQCKCERHKKEKSINASCSQISGKEQQ
• Endotoxin: ＜1EU/ug by LAL
• Purity: > 90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.056 mg/ml
• Publications:
  Clonal anergy of CD117+chB6+ B cell progenitors induced by avian leukosis virus subgroup J is associated with immunological tolerance (2019)

Gene Information

• Gene Name: IL7 interleukin 7 [ Gallus gallus (chicken) ]
• Official Symbol: IL7
• Synonyms: IL-7
• Gene ID: 420193
• mRNA Refseq: NM_001398241
• Protein Refseq: NP_001385170
• UniProt ID: B1GVZ6