| Species : |
Chicken |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. IL7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. IL7 plays an essential role in lymphoid cell survival, and in the maintenance of naive and memory T cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
| Form : |
50mM Tris, 300mM NaCl, pH 8.0. |
| Molecular Mass : |
15 kDa |
| AA Sequence : |
MHHHHHHSSCTMGNKTTEIRVKYENILSHDIEELVNMSAEYRDRCCKNKRHEHNKVFFCNDTQEIGSLQSMACNMLRFFNKQKINKEFRRKAALVSCGTLQVLQCKCERHKKEKSINASCSQISGKEQQ |
| Endotoxin : |
＜1EU/ug by LAL |
| Purity : |
> 90% |
| Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : |
0.056 mg/ml |
| Publications : |
|
