Recombinant Human IL8 Protein

Cat.No. : IL8-189H
Product Overview : Recombinant Human IL8 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Interleukin 8 (IL-8 or CXCL8) is a member of the CXC cytokine family and is produced by macrophages, epithelial, smooth muscle, and endothelial cells. IL-8 binds the G protein-coupled serpentine receptors CXCR1 and CXCR2. IL-8 recruits innate immune cells, induces phagocytosis, and stimulates angiogenesis.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 8.9 kDa (77 aa)
AA Sequence : AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IL8 interleukin 8 [ Homo sapiens (human) ]
Official Symbol IL8
Synonyms IL8; interleukin 8; interleukin-8; 3 10C; alveolar macrophage chemotactic factor I; AMCF I; b ENAP; beta endothelial cell derived neutrophil activating peptide; chemokine (C X C motif) ligand 8; CXCL8; GCP 1; GCP1; granulocyte chemotactic protein 1; IL 8; K60; LECT; LUCT; lung giant cell carcinoma derived chemotactic protein; lymphocyte derived neutrophil activating peptide; LYNAP; MDNCF; MONAP; monocyte derived neutrophil chemotactic factor; monocyte derived neutrophil activating peptide; NAF; NAP 1; NAP1; neutrophil activating peptide 1; SCYB8; TSG 1; tumor necrosis factor induced gene 1; emoctakin; T-cell chemotactic factor; neutrophil-activating peptide 1; chemokine (C-X-C motif) ligand 8; beta-thromboglobulin-like protein; tumor necrosis factor-induced gene 1; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; small inducible cytokine subfamily B, member 8; lung giant cell carcinoma-derived chemotactic protein; beta endothelial cell-derived neutrophil activating peptide; GCP-1; NAP-1;
Gene ID 3576
mRNA Refseq NM_000584
Protein Refseq NP_000575
MIM 146930
UniProt ID P10145

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL8 Products

Required fields are marked with *

My Review for All IL8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon