Recombinant Human INHBE Protein, GST-tagged

Cat.No. : INHBE-5115H
Product Overview : Human INHBE full-length ORF ( AAH05161, 21 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : INHBE is a member of the activin beta family (see INHBA; MIM 147290) that plays a role in pancreatic exocrine cell growth and proliferation (Hashimoto et al., 2006 [PubMed 16426570]).[supplied by OMIM
Molecular Mass : 62.04 kDa
AA Sequence : GTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name INHBE inhibin, beta E [ Homo sapiens ]
Official Symbol INHBE
Synonyms INHBE; inhibin, beta E; inhibin beta E chain; activin; MGC4638; activin beta E; activin beta-E chain;
Gene ID 83729
mRNA Refseq NM_031479
Protein Refseq NP_113667
MIM 612031
UniProt ID P58166

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INHBE Products

Required fields are marked with *

My Review for All INHBE Products

Required fields are marked with *

0
cart-icon