Recombinant Human INHBE Protein, N-His tagged
Cat.No. : | INHBE-12H |
Product Overview : | Recombinant Human INHBE Protein with N-His tag was expressed in HEK293. |
Availability | August 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate an inhibin beta subunit. Inhibins have been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. This gene may be upregulated under conditions of endoplasmic reticulum stress, and this protein may inhibit cellular proliferation and growth in pancreas and liver. |
Molecular Mass : | The protein has a calculated MW of 37.8 kDa. |
AA Sequence : | HHHHHHHHDDDDKGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.14 mg/mL by BCA |
Storage Buffer : | PBS, pH 7.4, 10% Glycerol, 1% SKL |
Gene Name | INHBE inhibin, beta E [ Homo sapiens (human) ] |
Official Symbol | INHBE |
Synonyms | INHBE; inhibin, beta E; inhibin beta E chain; activin; MGC4638; activin beta E; activin beta-E chain; |
Gene ID | 83729 |
mRNA Refseq | NM_031479 |
Protein Refseq | NP_113667 |
MIM | 612031 |
UniProt ID | P58166 |
◆ Recombinant Proteins | ||
INHBE-8216M | Recombinant Mouse INHBE Protein | +Inquiry |
INHBE-3068R | Recombinant Rat INHBE Protein | +Inquiry |
INHBE-3634H | Recombinant Human INHBE Protein (Thr237-Ser350), His tagged | +Inquiry |
INHBE-5115H | Recombinant Human INHBE Protein, GST-tagged | +Inquiry |
INHBE-458H | Recombinant Human INHBE Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHBE-5203HCL | Recombinant Human INHBE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INHBE Products
Required fields are marked with *
My Review for All INHBE Products
Required fields are marked with *