Recombinant Human INHBE Protein, N-His tagged
| Cat.No. : | INHBE-35H |
| Product Overview : | Recombinant Human INHBE protein with N-His tag was expressed in HEK293. |
| Availability | September 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Description : | This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate an inhibin beta subunit. Inhibins have been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. This gene may be upregulated under conditions of endoplasmic reticulum stress, and this protein may inhibit cellular proliferation and growth in pancreas and liver. |
| Molecular Mass : | 14.1 kDa |
| AA Sequence : | HHHHHHHHDDDDKTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.47 mg/mL by BCA |
| Storage Buffer : | PBS, pH7.4, 10% Glycerol, 1% SKL |
| Gene Name | INHBE inhibin subunit beta E [ Homo sapiens (human) ] |
| Official Symbol | INHBE |
| Synonyms | INHBE; inhibin subunit beta E; inhibin beta E chain; activin beta-E chain; inhibin beta E subunit |
| Gene ID | 83729 |
| mRNA Refseq | NM_031479 |
| Protein Refseq | NP_113667 |
| MIM | 612031 |
| UniProt ID | P58166 |
| ◆ Recombinant Proteins | ||
| INHBE-12H | Recombinant Human INHBE Protein, N-His tagged | +Inquiry |
| INHBE-3634H | Recombinant Human INHBE Protein (Thr237-Ser350), His tagged | +Inquiry |
| INHBE-797H | Recombinant Human INHBE protein, His-tagged | +Inquiry |
| INHBE-5892HF | Recombinant Full Length Human INHBE Protein, GST-tagged | +Inquiry |
| INHBE-8216M | Recombinant Mouse INHBE Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INHBE-5203HCL | Recombinant Human INHBE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INHBE Products
Required fields are marked with *
My Review for All INHBE Products
Required fields are marked with *
