Recombinant Full Length Human INHBE Protein, GST-tagged
Cat.No. : | INHBE-5892HF |
Product Overview : | Human INHBE full-length ORF ( AAH05161, 21 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 21-350 amino acids |
Description : | INHBE is a member of the activin beta family (see INHBA; MIM 147290) that plays a role in pancreatic exocrine cell growth and proliferation (Hashimoto et al., 2006 [PubMed 16426570]).[supplied by OMIM |
Molecular Mass : | 62.04 kDa |
AA Sequence : | GTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | INHBE inhibin, beta E [ Homo sapiens ] |
Official Symbol | INHBE |
Synonyms | INHBE; inhibin, beta E; inhibin beta E chain; activin; MGC4638; activin beta E; activin beta-E chain; |
Gene ID | 83729 |
mRNA Refseq | NM_031479 |
Protein Refseq | NP_113667 |
MIM | 612031 |
UniProt ID | P58166 |
◆ Recombinant Proteins | ||
INHBE-4550M | Recombinant Mouse INHBE Protein, His (Fc)-Avi-tagged | +Inquiry |
INHBE-797H | Recombinant Human INHBE protein, His-tagged | +Inquiry |
INHBE-5115H | Recombinant Human INHBE Protein, GST-tagged | +Inquiry |
INHBE-12H | Recombinant Human INHBE Protein, N-His tagged | +Inquiry |
INHBE-34H | Recombinant Human INHBE Protein, N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHBE-5203HCL | Recombinant Human INHBE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INHBE Products
Required fields are marked with *
My Review for All INHBE Products
Required fields are marked with *