Recombinant Human ISG15, StrepII-tagged
Cat.No. : | ISG15-258H |
Product Overview : | Purified, full-length human recombinant ISG15 or Ubiquitin-like protein (amino acids 2-157, 156 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 17 kDa. (Accession NP_005092.1; UniProt P05161) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 2-157, 156 a.a. |
Description : | ISG15 is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVD KCDEPLSILVRNNKG |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | ISG15 ISG15 ubiquitin-like modifier [ Homo sapiens ] |
Official Symbol | ISG15 |
Synonyms | ISG15; ISG15 ubiquitin-like modifier; G1P2, interferon, alpha inducible protein (clone IFI 15K); ubiquitin-like protein ISG15; IFI15; UCRP; ubiquitin cross-reactive protein; interferon-induced 15 kDa protein; interferon-induced 17 kDa protein; interferon-stimulated protein, 15 kDa; interferon-induced 17-kDa/15-kDa protein; interferon, alpha-inducible protein (clone IFI-15K); G1P2; IP17; hUCRP; |
Gene ID | 9636 |
mRNA Refseq | NM_005101 |
Protein Refseq | NP_005092 |
MIM | 147571 |
UniProt ID | P05161 |
Chromosome Location | 1p36.33 |
Pathway | Antiviral mechanism by IFN-stimulated genes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; ISG15 antiviral mechanism, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem; Interferon alpha/beta signaling, organism-specific biosystem; |
Function | protein tag; |
◆ Recombinant Proteins | ||
ISG15-5101HF | Recombinant Full Length Human ISG15 Protein, GST-tagged | +Inquiry |
ISG15-3330H | Recombinant Human ISG15 Protein (Met1-Gly157), N-His tagged | +Inquiry |
ISG15-1002H | Recombinant Human ISG15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Isg15-3120H | Recombinant Human Isg15 protein, GST-tagged | +Inquiry |
ISG15-2306R | Recombinant Rhesus monkey ISG15 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISG15-5152HCL | Recombinant Human ISG15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ISG15 Products
Required fields are marked with *
My Review for All ISG15 Products
Required fields are marked with *
0
Inquiry Basket