Recombinant Human ISG15 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ISG15-1002H |
Product Overview : | ISG15 MS Standard C13 and N15-labeled recombinant protein (NP_005092) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. |
Molecular Mass : | 17.9 kDa |
AA Sequence : | MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ISG15 ISG15 ubiquitin-like modifier [ Homo sapiens (human) ] |
Official Symbol | ISG15 |
Synonyms | ISG15; ISG15 ubiquitin-like modifier; G1P2, interferon, alpha inducible protein (clone IFI 15K); ubiquitin-like protein ISG15; IFI15; UCRP; ubiquitin cross-reactive protein; interferon-induced 15 kDa protein; interferon-induced 17 kDa protein; interferon-stimulated protein, 15 kDa; interferon-induced 17-kDa/15-kDa protein; interferon, alpha-inducible protein (clone IFI-15K); G1P2; IP17; hUCRP; |
Gene ID | 9636 |
mRNA Refseq | NM_005101 |
Protein Refseq | NP_005092 |
MIM | 147571 |
UniProt ID | P05161 |
◆ Recombinant Proteins | ||
ISG15-258H | Recombinant Human ISG15, StrepII-tagged | +Inquiry |
ISG15-2306R | Recombinant Rhesus monkey ISG15 Protein, His-tagged | +Inquiry |
Isg15-886M | Recombinant Mouse Isg15 protein, His-tagged | +Inquiry |
ISG15-3329H | Recombinant Human ISG15 Protein (Gly2-Gly157), C-His tagged | +Inquiry |
ISG15-28728TH | Recombinant Human ISG15 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISG15-5152HCL | Recombinant Human ISG15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ISG15 Products
Required fields are marked with *
My Review for All ISG15 Products
Required fields are marked with *