Recombinant Human Isg15 protein, GST-tagged
Cat.No. : | Isg15-3120H |
Product Overview : | Recombinant Human Isg15 protein(P05161)(2-157aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-157aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.3 kDa |
AA Sequence : | AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGGGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ISG15 ISG15 ubiquitin-like modifier [ Homo sapiens ] |
Official Symbol | Isg15 |
Synonyms | ISG15; ISG15 ubiquitin-like modifier; G1P2, interferon, alpha inducible protein (clone IFI 15K); ubiquitin-like protein ISG15; IFI15; UCRP; ubiquitin cross-reactive protein; interferon-induced 15 kDa protein; interferon-induced 17 kDa protein; interferon-stimulated protein, 15 kDa; interferon-induced 17-kDa/15-kDa protein; interferon, alpha-inducible protein (clone IFI-15K); G1P2; IP17; hUCRP; |
Gene ID | 9636 |
mRNA Refseq | NM_005101 |
Protein Refseq | NP_005092 |
MIM | 147571 |
UniProt ID | P05161 |
◆ Recombinant Proteins | ||
ISG15-8009Z | Recombinant Zebrafish ISG15 | +Inquiry |
ISG15-2606H | Recombinant Human ISG15 protein | +Inquiry |
ISG15-3329H | Recombinant Human ISG15 Protein (Gly2-Gly157), C-His tagged | +Inquiry |
ISG15-4333H | Recombinant Human ISG15 protein, His-tagged | +Inquiry |
ISG15-931HFL | Recombinant Full Length Human ISG15 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISG15-5152HCL | Recombinant Human ISG15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Isg15 Products
Required fields are marked with *
My Review for All Isg15 Products
Required fields are marked with *
0
Inquiry Basket