Recombinant Full Length Human ISG15 Protein, GST-tagged
Cat.No. : | ISG15-5101HF |
Product Overview : | Human G1P2 full-length ORF ( ENSP00000368699, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 165 amino acids |
Description : | ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha (IFNA; MIM 147660) and -beta (IFNB; MIM 147640) (Zhao et al., 2005 [PubMed 16009940]).[supplied by OMIM |
Molecular Mass : | 44.3 kDa |
AA Sequence : | MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ISG15 ISG15 ubiquitin-like modifier [ Homo sapiens ] |
Official Symbol | ISG15 |
Synonyms | ISG15; ISG15 ubiquitin-like modifier; G1P2, interferon, alpha inducible protein (clone IFI 15K); ubiquitin-like protein ISG15; IFI15; UCRP; ubiquitin cross-reactive protein; interferon-induced 15 kDa protein; interferon-induced 17 kDa protein; interferon-stimulated protein, 15 kDa; interferon-induced 17-kDa/15-kDa protein; interferon, alpha-inducible protein (clone IFI-15K); G1P2; IP17; hUCRP; |
Gene ID | 9636 |
mRNA Refseq | NM_005101 |
Protein Refseq | NP_005092 |
MIM | 147571 |
UniProt ID | P05161 |
◆ Recombinant Proteins | ||
ISG15-242H | Recombinant Human ISG15 | +Inquiry |
ISG15-8009Z | Recombinant Zebrafish ISG15 | +Inquiry |
ISG15-2127R | Recombinant Rhesus Macaque ISG15 Protein, His (Fc)-Avi-tagged | +Inquiry |
ISG15-3422H | Recombinant Human ISG15 protein, His-tagged | +Inquiry |
Isg15-009M | Recombinant Mouse Isg15 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISG15-5152HCL | Recombinant Human ISG15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ISG15 Products
Required fields are marked with *
My Review for All ISG15 Products
Required fields are marked with *