Recombinant Human ITGB2
Cat.No. : | ITGB2-26325TH |
Product Overview : | Recombinant fragment of Human CD18 protein with an N terminal proprietary tag; predicted mwt: 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The product of this gene belongs to the integrin beta chain family of proteins. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. This gene encodes the integrin beta chain beta 2. A given chain may combine with multiple partners resulting in different integrins. For example, beta 2 combines with the alpha L chain to form the integrin LFA-1, and combines with the alpha M chain to form the integrin Mac-1. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Defects in this gene are the cause of leukocyte adhesion deficiency type I (LAD1). Two transcript variants encoding the same protein have been identified for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGP |
Sequence Similarities : | Belongs to the integrin beta chain family.Contains 1 VWFA domain. |
Gene Name | ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) [ Homo sapiens ] |
Official Symbol | ITGB2 |
Synonyms | ITGB2; integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); CD18, integrin, beta 2 (antigen CD18 (p95), lymphocyte function associated antigen 1; macrophage antigen 1 (mac 1) beta subunit) , MFI7; integrin beta-2; LFA 1; MAC 1; |
Gene ID | 3689 |
mRNA Refseq | NM_000211 |
Protein Refseq | NP_000202 |
MIM | 600065 |
Uniprot ID | P05107 |
Chromosome Location | 21q22.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; CXCR3-mediated signaling events, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; |
Function | binding; glycoprotein binding; protein kinase binding; receptor activity; |
◆ Recombinant Proteins | ||
ITGB2-2556H | Recombinant Human ITGB2 protein(451-520 aa), C-His-tagged | +Inquiry |
ITGB2-248HFL | Active Recombinant Full Length Human ITGB2 Protein, C-Flag-tagged | +Inquiry |
ITGB2-279HF | Recombinant Full Length Human ITGB2 Protein | +Inquiry |
RFL179HF | Recombinant Full Length Human Integrin Beta-2(Itgb2) Protein, His-Tagged | +Inquiry |
Itgb2-7145M | Recombinant Mouse Itgb2 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB2-5125HCL | Recombinant Human ITGB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGB2 Products
Required fields are marked with *
My Review for All ITGB2 Products
Required fields are marked with *
0
Inquiry Basket