Recombinant Human ITLN1 Protein, GST-tagged

Cat.No. : ITLN1-4958H
Product Overview : Human ITLN1 full-length ORF ( NP_060095.2, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ITLN1 (Intelectin 1) is a Protein Coding gene. Diseases associated with ITLN1 include Lipid-Rich Carcinoma and Obesity. Among its related pathways are Defensins and Innate Immune System. GO annotations related to this gene include carbohydrate binding. An important paralog of this gene is ITLN2.
Molecular Mass : 61.4 kDa
AA Sequence : MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ITLN1 intelectin 1 (galactofuranose binding) [ Homo sapiens ]
Official Symbol ITLN1
Synonyms ITLN1; intelectin 1 (galactofuranose binding); intelectin-1; FLJ20022; hIntL; HL 1; ITLN; LFR; ITLN-1; endothelial lectin HL-1; galactofuranose-binding lectin; intestinal lactoferrin receptor; HL1; HL-1; INTL; omentin;
Gene ID 55600
mRNA Refseq NM_017625
Protein Refseq NP_060095
MIM 609873
UniProt ID Q8WWA0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITLN1 Products

Required fields are marked with *

My Review for All ITLN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon