Recombinant Full Length Human ITLN1 Protein, GST-tagged
Cat.No. : | ITLN1-5815HF |
Product Overview : | Human ITLN1 full-length ORF ( NP_060095.2, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 313 amino acids |
Description : | ITLN1 (Intelectin 1) is a Protein Coding gene. Diseases associated with ITLN1 include Lipid-Rich Carcinoma and Obesity. Among its related pathways are Defensins and Innate Immune System. GO annotations related to this gene include carbohydrate binding. An important paralog of this gene is ITLN2. |
Molecular Mass : | 61.4 kDa |
AA Sequence : | MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITLN1 intelectin 1 (galactofuranose binding) [ Homo sapiens ] |
Official Symbol | ITLN1 |
Synonyms | ITLN1; intelectin 1 (galactofuranose binding); intelectin-1; FLJ20022; hIntL; HL 1; ITLN; LFR; ITLN-1; endothelial lectin HL-1; galactofuranose-binding lectin; intestinal lactoferrin receptor; HL1; HL-1; INTL; omentin; |
Gene ID | 55600 |
mRNA Refseq | NM_017625 |
Protein Refseq | NP_060095 |
MIM | 609873 |
UniProt ID | Q8WWA0 |
◆ Recombinant Proteins | ||
ITLN1-29874TH | Recombinant Human ITLN1, FLAG-tagged | +Inquiry |
ITLN1-912H | Recombinant Human Intelectin 1 (Galactofuranose Binding), His-tagged | +Inquiry |
ITLN1-3558H | Recombinant Human ITLN1 Protein (Thr19-Ser298), N-His tagged | +Inquiry |
ITLN1-4513Z | Recombinant Zebrafish ITLN1 | +Inquiry |
ITLN1-113H | Recombinant Human Intelectin 1 (galactofuranose binding) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITLN1 Products
Required fields are marked with *
My Review for All ITLN1 Products
Required fields are marked with *
0
Inquiry Basket