Recombinant Human ITLN1 protein, His&Myc-tagged

Cat.No. : ITLN1-6743H
Product Overview : Recombinant Human ITLN1 protein(Q8WWA0)(19-298aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 19-298a.a.
Tag : His&Myc
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 38.6 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYS
Gene Name ITLN1 intelectin 1 (galactofuranose binding) [ Homo sapiens ]
Official Symbol ITLN1
Synonyms ITLN1; intelectin 1 (galactofuranose binding); intelectin-1; FLJ20022; hIntL; HL 1; ITLN; LFR; ITLN-1; endothelial lectin HL-1; galactofuranose-binding lectin; intestinal lactoferrin receptor; HL1; HL-1; INTL; omentin;
Gene ID 55600
mRNA Refseq NM_017625
Protein Refseq NP_060095
MIM 609873
UniProt ID Q8WWA0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITLN1 Products

Required fields are marked with *

My Review for All ITLN1 Products

Required fields are marked with *

0
cart-icon