Recombinant Human ITLN1 protein, His&Myc-tagged
| Cat.No. : | ITLN1-6743H |
| Product Overview : | Recombinant Human ITLN1 protein(Q8WWA0)(19-298aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 19-298a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 38.6 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYS |
| Gene Name | ITLN1 intelectin 1 (galactofuranose binding) [ Homo sapiens ] |
| Official Symbol | ITLN1 |
| Synonyms | ITLN1; intelectin 1 (galactofuranose binding); intelectin-1; FLJ20022; hIntL; HL 1; ITLN; LFR; ITLN-1; endothelial lectin HL-1; galactofuranose-binding lectin; intestinal lactoferrin receptor; HL1; HL-1; INTL; omentin; |
| Gene ID | 55600 |
| mRNA Refseq | NM_017625 |
| Protein Refseq | NP_060095 |
| MIM | 609873 |
| UniProt ID | Q8WWA0 |
| ◆ Recombinant Proteins | ||
| ITLN1-113H | Recombinant Human Intelectin 1 (galactofuranose binding) | +Inquiry |
| ITLN1-3559H | Recombinant Human ITLN1 Protein (Cys31-Gly253), N-His tagged | +Inquiry |
| ITLN1-4513Z | Recombinant Zebrafish ITLN1 | +Inquiry |
| Itln1-5638R | Recombinant Rat Itln1 protein, His-tagged | +Inquiry |
| ITLN1-3575H | Recombinant Human ITLN1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITLN1 Products
Required fields are marked with *
My Review for All ITLN1 Products
Required fields are marked with *


